SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|166161|fgenesh2_pg.C_sca_56000074 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|166161|fgenesh2_pg.C_sca_56000074
Domain Number 1 Region: 28-66
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000497
Family LDL receptor-like module 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|166161|fgenesh2_pg.C_sca_56000074
Sequence length 192
Sequence
MDLRNCYERPKEYKFCESGACVLNNEYCPCSHNFFQCRFAAKCIHSSLVCNNVDDCGNNK
DEENCFKTDDAQPQECHLSTGAIIGISIGVAVVFILLVLAMLYWLHRKKRLRSQNTSSLE
PLRIQTKQSLGDVTSSEGSDVNKRNSGYNKVPLDDSFGPFNDVLCTSTPKPDARRQIVQM
DPMPPILILKPS
Download sequence
Identical sequences V3ZZ20
XP_009061464.1.39240 jgi|Lotgi1|166161|fgenesh2_pg.C_sca_56000074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]