SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|166380|fgenesh2_pg.C_sca_58000009 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Lotgi1|166380|fgenesh2_pg.C_sca_58000009
Domain Number - Region: 413-525
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00732
Family Growth factor receptor domain 0.0072
Further Details:      
 
Domain Number - Region: 287-408
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0298
Family Growth factor receptor domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|166380|fgenesh2_pg.C_sca_58000009
Sequence length 592
Sequence
MYTMLQYWTGVVVWMFLAHLGETRDCPGSRFGSECKFRCHCKDQASCNVKDGGCPAGCDA
GWSGTACQRQNLAYLAPVEIRKVPDRGVEVVDEDVTTCVSSIPNRTGWLKIDLGSSQLVY
SMRLVPGTVIFRIPSPLEVLEGPNTSMINWRIHVTDENHDDIFWGFPCTTLKSEEGDVQC
DQADVYGRYVSIFSLDRPVNVCDFHIYSCSNYTYGKINCNGRCSCLNSTEVCQSILGTCK
SGCRPGLTGSGCDQVCVMSYGSSCVHNCGECYDGESCDRISGVCPAGCEPGYTGSKCTEV
CLRGYYGISCRFPCGHCKNSAICDHVTGYCLDGCKSGWFGRKCLKECKRGSYGEDCKFTC
LNCISSLCNKETGLCTIGCIAGWEGVFCNQGCLSGTYGTGCRETCGNCRSLPCRKDTGSC
NKFGCQSGFYGDTCKHECPAGKYGANCKFTCGMCGNGASCDPRNGSCPYKCDVGWIGNKC
QSVCPEGMFGEACNSTCGVCKSREPCDPVTGRCKNGCAEGFHGDNCAETGGDTGDVSNAV
MSTFVSAAGAIVFLFLTLLCACIVIKWRQEKNLEDYDHRVKRKLLTAANGHV
Download sequence
Identical sequences V3Z9C0
XP_009061700.1.39240 jgi|Lotgi1|166380|fgenesh2_pg.C_sca_58000009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]