SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|166436|fgenesh2_pg.C_sca_58000065 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Lotgi1|166436|fgenesh2_pg.C_sca_58000065
Domain Number - Region: 560-685
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00889
Family Growth factor receptor domain 0.0058
Further Details:      
 
Domain Number - Region: 334-432
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0889
Family Growth factor receptor domain 0.0043
Further Details:      
 
Domain Number - Region: 435-557
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0973
Family Growth factor receptor domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|166436|fgenesh2_pg.C_sca_58000065
Sequence length 690
Sequence
MMKILEILLCLSFFRATVQQFDCSVCKVCDNSTCIECIEGRYGISCGSFCSLKCSGRCRQ
SDGYCTSGCDEGYWGPGGLCDQTCSNCNPGGCVMNSGLCIAIGCRTGWYGTTCNNKCNSN
CDGNCNQSNGNCNQCIPGKYGTDCQLDCSNCKDTCNKNNGVCNNGCKEGLWGTSCTKTCP
NCQSSGCDIDNGNCNNPGCRIGWYGDSCNDKCNERCNDGCKQDTGYCNKCNKGVYGNVCD
KNCNKGCLDGCNIDGSCKCKSTYYGTNCSKQCSSNCVDSLCNEISVGYNSCIRGCVAGYK
GLYCDKQCPSSCPICNRFDGSCTECSKGFYGTECQLKCPEQCDKCKIKEGTCESCNPKYH
GPVCSKRCSDKCLNGECNGVGGRCIDCIPGTFGDNCERSCSNGCIGDTSSTTCDRNGSCI
SGCINRIYGEKCNLNCSKNCYGSCNRSNGYCNSCLSGYFSDNCNQKCSIHCNGDCDRSTG
NCGKCNEGYFGDNCNQNCSINCNGGCQKSSGSCLECNAGYYGDYCKQQCNDKCINNECLR
NGQCRFGCMNGKTGSQCDGNCNSNCTICLQTDGNICKECKPGLYGISCDKLCNNTCKKVN
SKPACNITTGKCTTGCIDGYKGYYCQDTCLDNCISCNNNQCTSCNTGWYGNQCQTKCNSN
CINRCDQATGDCLDGCIDGKSGKHCKQEIG
Download sequence
Identical sequences V3ZY41
jgi|Lotgi1|166436|fgenesh2_pg.C_sca_58000065 XP_009061749.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]