SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|166958|fgenesh2_pg.C_sca_62000082 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|166958|fgenesh2_pg.C_sca_62000082
Domain Number 1 Region: 408-558
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 4.71e-39
Family Toll/Interleukin receptor TIR domain 0.000082
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|166958|fgenesh2_pg.C_sca_62000082
Domain Number - Region: 281-311
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0109
Family EGF-type module 0.056
Further Details:      
 
Domain Number - Region: 312-346
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0151
Family EGF-type module 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|166958|fgenesh2_pg.C_sca_62000082
Sequence length 646
Sequence
MRYCKVWSCLMLVLVLESQKFPTSTAFHNGESSKSDGKYSRFYDMDPSRFRRDNRLVNQT
TKSEDSCCTVFPTICNTYGDCVLDINICVQLCVCATAADGYWCTQVIKLLTSGASTIATT
TTLPSTLPPTAIPKLYASFVETDDDSNHTDSSSETSLSHSTTLDPRGTTLEILQFPSVSP
LVPPPVISSPSNPLRLNNSVTTHISGNETQGTSITTIASSIKNVISRLVKSESILKNLTR
VRNNCNNCYDGKCILGKDYQPRCARNIDMGAENTTCPLGFDCKNGFCVIESGKSGVSCEC
FKNWTGHFCNEPCLLNCGDHGKCVKHETEVCACYWNYTGVNCETHDPSMNLMKGATTIKV
TNTPWSVIGICFGLLVVLLMLLILIPYYLYRKQWIPMRKLVYYFQHYEDDDGKEYDAFIS
YKSSKSDEQFVVQKLYPKLEKELDFKLCLHFRDFLPGEAIANSIIQAIQNSRRTIMILTP
NYIESEWCRLEYQTAQHEMLKLKHKIIPIILEDIDHVKSVDSNLKSIIDTVTYIKWPLGE
ISKEEEKFWKLLELTMPKKKLDCSSSTSRTSSEVPLSGVTPLPSSDTLSDDVFTSSVSVE
IEPDDNAMVEVTPLDENPHIISCLEHSGDCQILPNEHGLLSDYPAV
Download sequence
Identical sequences V3ZVQ1
XP_009062664.1.39240 jgi|Lotgi1|166958|fgenesh2_pg.C_sca_62000082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]