SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|167107|fgenesh2_pg.C_sca_63000111 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|167107|fgenesh2_pg.C_sca_63000111
Domain Number 1 Region: 416-454
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000209
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 2 Region: 176-280
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000419
Family Spermadhesin, CUB domain 0.0045
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|167107|fgenesh2_pg.C_sca_63000111
Domain Number - Region: 291-378
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00929
Family Spermadhesin, CUB domain 0.0087
Further Details:      
 
Domain Number - Region: 60-111
Classification Level Classification E-value
Superfamily Resistin 0.0968
Family Resistin 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|167107|fgenesh2_pg.C_sca_63000111
Sequence length 905
Sequence
MGKVNCVIFLSILLVLVELSYTQRSKNLDLCKKDHRFIPNGDHLPSVGSNMKVYFSVKEN
VEQQCLMRFTTCVSCKLNLTSVSSYLSFSTCHKQLDVTNSKCTQGCTYLHVFDPDYRNET
TKYFTGPFDVYRSESKTMYIVFCSNGIQYKHVNITLQLSVEEKKEVYKGSSQDIHTGYNQ
IVMSPFFPNYYAENSEEYIYEFRAVNHEDYVFLVFDDWNLSPYSTIQFENTNIQGPVKGS
ASRPSVLSNGPYIKLHFKTGKSSTSQIRSYMGFKLSYKFYDKRKYVQRRETNCGEYILNR
DGGTLMFQPSSNINDFYDCIWVVKVQKGYDSVYCKLEAFESIRDYDSQNRLEIRNGLTSQ
GTLKASVSPGTVDASSLYGHDSDTGFYIRLYGRYRDAKDFILTYASYKLGECVGDRYFNC
DNKKCINSQFVCDGYNHCGDGSDEKSYSCNTYTRPEDSPNSYTLSVGVIIPIVISVFLIV
VICLLLIFIRRCRRLQSTIPDDSQRISTVSSHNPQSGGGRGRRHRSRQQRISMNLTISQD
SPPTYDEVIRSTPIGHLNMAFMWSNAEDGVIQPPTYEEAISSTGDLPQLSISHNLSSSST
ETTASAARPVSELSSSTDSSYHQRPRQISSSSSSSAATVTGNPNWPGEPVPSSVPHSTSR
SSRNKPQDDLIVSANALGDKPNEGQAEHTQGHAPPQQLVTPKECGMRYDPENQAAGAGIS
AVPPNSAVSSDSQDIDTSRALQEYVARKKYQKKRASNDGQTSNGERSESHVRSPRHRHLA
SEGSSRSEQSPSSSSDKNHRKRQDRRGGNSRSRDSPSAHSVQESLPPPPPSPPQRSVDPS
RSERPNCSTSLLSPSHGSFSDRVEANPPLEQSASDNIRLSESTQNLVLNLQVNADDPPEN
TDIFV
Download sequence
Identical sequences V3Z6X9
jgi|Lotgi1|167107|fgenesh2_pg.C_sca_63000111 XP_009062816.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]