SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|168256|fgenesh2_pg.C_sca_73000096 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|168256|fgenesh2_pg.C_sca_73000096
Domain Number 1 Region: 127-303
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 6.41e-26
Family Fibrinogen C-terminal domain-like 0.0009
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|168256|fgenesh2_pg.C_sca_73000096
Domain Number - Region: 104-137
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0111
Family EGF-type module 0.033
Further Details:      
 
Domain Number - Region: 46-73
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0392
Family Pan module (APPLE domain) 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|168256|fgenesh2_pg.C_sca_73000096
Sequence length 322
Sequence
MEGGSALIGFLFALTSYYPCSGQGILATKFLKTSVIVEYESVRIEPMFTDPVIHNQECSQ
LCTRDYGCRKYMVATDITTHDKLCYRYSDGENCVASSSELSNKESVCYRKLKQSNGTHCV
SPVGYYGTNCEYIIKDCYHGQYINFKSTSLSYVKPANKIFEVLCDFNNGMTNIQIRRSDS
VEVNFNRTWNDYVNGFGNTHSEYWLGLQNIFDLTNNVPSFNLDITLNHSCSILYPNFKLM
YSTSDFVFSASAPPSDGCFIGDIDFRGAQFVTYDRPSTPRSCALPQVGGWWYTPWPCTMN
LNSPRDTLNDVHISFVMMRLYP
Download sequence
Identical sequences V3ZR28
XP_009064380.1.39240 jgi|Lotgi1|168256|fgenesh2_pg.C_sca_73000096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]