SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|168371|fgenesh2_pg.C_sca_74000081 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|168371|fgenesh2_pg.C_sca_74000081
Domain Number 1 Region: 163-198
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000327
Family LDL receptor-like module 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|168371|fgenesh2_pg.C_sca_74000081
Sequence length 412
Sequence
MLTRVVFPMLLYLVMVSAYTTKVNYVKRKCGSTIMVSTAERIVLEYDDDTAEEDCEIKLQ
AYDPYNNYDNINLHLRFLELDLPCAQAAVIIDKFDTTNEIYGLNRRFQHSGIGESVCGDE
VPDKLYESNLKKMSINFHKRIPHSPIYDSYFDILVTKVNNGLCDQNKEFECDSGRCVDES
LVCDDYYNCDDESDEDEDCFWTVGAIIGVAIGLIVVIALAVIGVVLICRKRKYGRFFRRK
QAPPIAKVRSNDQPYFSESTSSLAKQLTPIPYAPSLNPSITPNLSPASQKRAMGSTFKQF
NNGQQRDFGLTKKADEKYPKYKRNSRSDEHELKTVSAHVEESDSRRSSDSTHISLNGYVD
SKRSSSEPRRGSREQRRQGPRKISDYRNGSSSRMSSSSNQSANKSPSTCTDV
Download sequence
Identical sequences V4B872
jgi|Lotgi1|168371|fgenesh2_pg.C_sca_74000081 XP_009064499.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]