SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|168935|fgenesh2_pg.C_sca_80000063 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|168935|fgenesh2_pg.C_sca_80000063
Domain Number 1 Region: 1408-1459
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000502
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 2 Region: 281-337
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000614
Family EGF-type module 0.089
Further Details:      
 
Domain Number 3 Region: 1313-1354
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000067
Family Laminin-type module 0.0045
Further Details:      
 
Domain Number 4 Region: 1360-1405
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000642
Family Laminin-type module 0.0032
Further Details:      
 
Domain Number 5 Region: 1200-1252
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000865
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 6 Region: 806-851
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000195
Family Laminin-type module 0.0039
Further Details:      
 
Domain Number 7 Region: 901-949
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000265
Family Laminin-type module 0.028
Further Details:      
 
Domain Number 8 Region: 335-379
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000335
Family Laminin-type module 0.016
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|168935|fgenesh2_pg.C_sca_80000063
Domain Number - Region: 756-803
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000234
Family Laminin-type module 0.0087
Further Details:      
 
Domain Number - Region: 415-465
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000234
Family Laminin-type module 0.019
Further Details:      
 
Domain Number - Region: 854-894
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000391
Family Laminin-type module 0.018
Further Details:      
 
Domain Number - Region: 1262-1315
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000402
Family Laminin-type module 0.017
Further Details:      
 
Domain Number - Region: 1158-1202
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00232
Family Laminin-type module 0.084
Further Details:      
 
Domain Number - Region: 101-178
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00884
Family APC10-like 0.026
Further Details:      
 
Domain Number - Region: 510-550
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0335
Family Laminin-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|168935|fgenesh2_pg.C_sca_80000063
Sequence length 2111
Sequence
MYYKSVLFLFLLFSTYRFSNGQCSNKRGCFPKVKDFVADTANTAITLSATSTCSAPTRFE
GLGTADGKNFTCNVNNKIDNVRDRSPFSYEVDGKTLTGYNPNLDTYWQSGLTIATEGAVA
TPQVLELNLGSNFTIKDIKLYFKALNSPKDVKYDSRPKAIYFEKLDKDNNNWVPWRYFAE
NCNDFSGVEEQKVGGPDLSATSAFCVKDGHKIGGNAGGVHNDTFFVEFNPGLEYDPEFTD
NKEVADHFVTSGIRVQLHKPNSDKPLQSYYVVSDLSVHGYCYCYGHSSVCKGQNSDECEC
EHNTMGAHCEECMPLYNNQTWKMGKRNEANVCQKCFCNDHAESCHYDEGKGYGVCDNCLN
NTKGDFCDECISGYSINSYYTRDKTNETVTPPKPTGTCQDSSGASYDCGSYCILCGCNLE
GTVKTSLNNCASNGTCDCKTNVQGEKCSECKDGFWGLAESNVDGCTECEHIYYIFTYYID
NYLNDLHNNNNNNAETFNLTSENEDGCTQCDCDPGASKSNICDVTNGGQCECLNNIATRD
CRTTVTGYFAPKLDYFKFEAEFQTGILEGNKVDRPGEGVSDGTVTGRGLISLPASNTIQL
EFDTQLNKEFDIVLRYESSSAINGVTGDIKQLNGVPYECNGASIAADKVWAIPAAIPQAQ
SRGGLILARVCGRLNQKYTLTLTTTAASSLLIDSIVVLPVLETLQIYTSGDDKMKQKITS
CREASFGVNMPNRQSLNCTELEYSIMTQLIGGAMPCNCNSEGSVSTAVCNQYGGQCDCKE
GVTMRDCSICRVDSYGIDITNGCTLCNCNVGGSIKQSCNMTGDCSCKTNVTGKQCDQCLP
DQYGLSSGNGCQDCTCNMLYSVNNTCADSGQCICKPGIGQQNCDQCLPGFYNLTNDGCTE
CGCHAEGSINNVCDSGTGKCTCREMTTGEKCDQCVDGYFGVGGWSDEGCIKCLCSGHSTN
CSTGQGWFQAVKSSAWSIKDESAVDERWLGVDSEGNSITVDDEYVGIDIVMRITNTAKYL
DASHLYFKAPAKYMGDKRSAYGQYFTMNLRLSTHDELLGNYTEGDICIRGKYTDFVLAKD
IALPGTEKTTYNITMKESEWYINGTDKVRPTYTQFIQVLSGIDFIKVRGKWSNATDAETD
LYDFDLYISSKTNTTGSQPINNVESCYCPPEYQGEFCERCADGFKREKANGGPFSKCIPC
GCNGHSAGPCDDTTGICNCTHNTKGDKCQLCMDGYFGDATTGTANDCKPCMCPGNVVQGD
VNVFATTCQLDNGNQKCINCSEGHGGNRCEICLENYYGEPENAQVKGGKCVPCVCNDRAD
TCNTTTGVCIDCRNNTAGKECDICTEKYFGDAMTYDCKLCSCDSVGSDGKCNAATGQCEC
YPNVQGFNCDQCVPNSFNLTSGTGCQMCDCHAEGAIGLSCDVITGQCTCRSNVINRQCDA
CQAQFYKLNTVTGCDSCGCTEEGTAEATVTGGTKGVCNLITGDCTCKQPGIIGRTCNTCS
KNTKETYSGFVSVFNIGKYPNCVLCGECFDGWARKMDNIGLEFNDVEKKTNDIWANYGFK
TGESVTDDLNNIKTSILNANESVSRAENITNIVNNLTQELNMVVNEVNQLSTMLMDIETR
LNSSIESLASVASFNGDIEIDNITYTAESLDTKLTELTDQINAAYDKANKSFIHIQELSV
LVGSADQTTQQLRTRVQTAMSTLTVAEQTFNTASTVYNDTFLPGYNENEKSLSDGNQALT
SARTLLTELNSIITEMTTQFESANTTMNTVIQKTDEVKTRLETKLQESQTAYSDAKGLST
IATEAFNLVRQYKAAADKAFNDITGAFVAVLDGSKQLININNKIADIKTMVVQVNDVTIR
DKSELEVITTQIRETTISDADVAQANQNAQNALETAKNVLNITEKALDDSRTALEEVKGI
QENINDASNLRANATTLKTETDSFNNTIYNAIGQASSKVSEVGQLVTKTTAEVTNVQSFI
AKTSQCYSDAKSRSESSRNTANVALQQAKEVEKQQGEYTATETALNTDVDSKSTNQAVSE
LQTTKTSLDNVIGDLSKAQQIADITNMITLYGAQKTEMNQLQTDINNLEKELDDMLQALE
LTSESSTCVHS
Download sequence
Identical sequences V4B5V7
XP_009065469.1.39240 jgi|Lotgi1|168935|fgenesh2_pg.C_sca_80000063

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]