SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|168974|fgenesh2_pg.C_sca_81000020 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|168974|fgenesh2_pg.C_sca_81000020
Domain Number 1 Region: 8-44
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000246
Family Laminin-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|168974|fgenesh2_pg.C_sca_81000020
Sequence length 144
Sequence
MLRVRVGYLSEGACISCTRNTTGFNCERCRDGYRGDAINYKNCTAISDLDKDLLPLPAGY
IAGIVIAVILVLSFILAFIVYKWWKFPTMKPFWTVELKEDHEGVSFSAVDDQEFLKATET
RNKEGQFYEKQGRGMKYAQLREDV
Download sequence
Identical sequences V3ZHP3
XP_009065519.1.39240 jgi|Lotgi1|168974|fgenesh2_pg.C_sca_81000020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]