SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|169170|fgenesh2_pg.C_sca_82000112 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Lotgi1|169170|fgenesh2_pg.C_sca_82000112
Domain Number - Region: 15-98
Classification Level Classification E-value
Superfamily Prefoldin 0.0785
Family Prefoldin 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|169170|fgenesh2_pg.C_sca_82000112
Sequence length 140
Sequence
MAVDYHRQLLKRRIEHRLDNIRQKRRSLMVEDEQLKNQRQFLRRVREDMNHKLSDSTLIY
HDAIPELDEFLENSPEKIRVTKPKKSTSMSTLVKLKRKPSIKVSIKRRLSFNMFRKPSSK
SQEVAGFETVYKNGLKSTMC
Download sequence
Identical sequences V4B5E2
jgi|Lotgi1|169170|fgenesh2_pg.C_sca_82000112 XP_009065716.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]