SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|169286|fgenesh2_pg.C_sca_84000015 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|169286|fgenesh2_pg.C_sca_84000015
Domain Number 1 Region: 521-664
Classification Level Classification E-value
Superfamily Fibronectin type III 6.9e-17
Family Fibronectin type III 0.0049
Further Details:      
 
Domain Number 2 Region: 308-515
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000509
Family Fibronectin type III 0.0045
Further Details:      
 
Domain Number 3 Region: 36-65,179-213
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000341
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 4 Region: 229-314
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000653
Family Fibronectin type III 0.0031
Further Details:      
 
Domain Number 5 Region: 72-135
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000554
Family Fibronectin type III 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|169286|fgenesh2_pg.C_sca_84000015
Sequence length 694
Sequence
MACNHINNIAYLLCVFLLGHVKGEYGDSCITREDSCNVVNGSCYTNNNISKCSCNLNYYT
DNNMCNSVTELKPTGVVIEGTPTSSSVTIKWTVPTKDAIQSFNIKGNGPNIEKTQLNKNF
RAVTIAGLTPNTQYTDIKVETVVKTDRNPSLIVTSDPPFINFITSKAGYRETCVTPGTDQ
CDDTNTECVDIGDGNGNKCYCKEGFYTNNNQCFNAAELKTIIAGIIPKTNTATVSWTLPS
NSQFISSISIEVNGIINKSSISNTATSSEITGLQPGTMYSIKVISIVNTDRKQNYEVKSK
NVSNTTNPGKPGPLNSDNNYDTTKVMNIGFVKPTGGVDKYIVQITGPGLNTTFTQEPTTN
SITLPANTLQPGRQYNISIIAVYNGKNSAEFVGVFNTNSRGSDPVKDLNITNINSRSLTV
SWSYPDEDMGVLTAYILDVKIGSECIQQYIYVTDINNKPTTNNCAGVTPTYSVTDLKAGI
IQIIIDLLPYINYTLIVTPYNNVRPGSVASKSELTYIEAAGEPSNLNVIEINAKSFLVTW
NKPSLKTGPTTYYLYLYERNNLANNQASQLVKTHVVQGFDTEEYRVNDVVSYWYYRVELQ
ASTAAGNSSIKSIPEFQTLPSAPGKVKNLAIEKIKGQYSIAKVSWSCPNDRDRNGVIKNY
TLTSTLEYATNMGFKGEEAAIEYTAPTESRVFVI
Download sequence
Identical sequences V3ZGZ7
XP_009065853.1.39240 jgi|Lotgi1|169286|fgenesh2_pg.C_sca_84000015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]