SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|169300|fgenesh2_pg.C_sca_84000029 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|169300|fgenesh2_pg.C_sca_84000029
Domain Number 1 Region: 90-254
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.34e-27
Family Pentraxin (pentaxin) 0.013
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|169300|fgenesh2_pg.C_sca_84000029
Domain Number - Region: 855-1080
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000723
Family Rhodopsin-like 0.021
Further Details:      
 
Domain Number - Region: 33-62
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0733
Family EGF-type module 0.05
Further Details:      
 
Domain Number - Region: 286-338
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.0863
Family Hormone receptor domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|169300|fgenesh2_pg.C_sca_84000029
Sequence length 1139
Sequence
MFVGTEYARSLCGTSAPIDCFSLSPPYQCHSTYYTDPKCVDHPDGYGCECGPGFHWNTFM
CMSSAIDSRFEFKAVKPERYTLLLDKAFPKLKHFTISFWMNVTDVNQHGTILSYSHGTHN
NILRMMSGTSIRFEVFGIYKVTDFQLRPHQWYHVTWTWSSTDGKWNFYINGDKRQSGYLN
RTLREIPSGGQIVLGQSQPFEISAALDGDLSHLNIWNYVMEKEEIKNITKSCNFMYCGNA
VQWVEFRSGTRGGMKIRWPSGIFTGQCFTEKTAAISCDTFCSDLIGAQCNEEIKENIRWT
RTKAENTVSVQCPRLDDNSTIDIRPDDRIDGQATRVCKLQEDANDGIWLEPMIDGCISTD
LLQIKNMFTRLGKVDLNEISVLQLADKLLNHTIHNTYTNPIDIATVIDLLQIMVTTQGIA
PRTVTWQNGGITFARTKEVYPTFEQTTTFSQILGAIIDNLLSSKNDIGWNATQPRGVEGD
NLLSVLKMFANVISRSLIYHVIDGLVTYENAVIKVFKENIGKYVLLLTRGLLMPGAHKRF
SDKLRAHKETEFLQSVNFSYDNTCVWSENTSDLMKTGLMFEILSNAISCRGSTETWEILL
KIYISDKKCSCAPALNNQHVLPMCDSFFDKFVLIQENFLPSTTEFKIETYWIEEFFGSSF
PSKEDELEYKLKKNKGFLRVRRGVLMSQNTSDLPVFIGVSSFRYQKLAQNLPNKIYKGRK
KEDRVNTPIMAVYLHIGDLPITNLTSPILVDLPILNTFNISNPECVRVIHRERSREWYWS
RVGCRLLRYNGKSGRCACHIPGVFSITTDMYDVNWDKGDKRPHLMNFASYIGCAVSALFC
LITCIVHVYIGTSSATAALHRNLSISISCSQIVFMFGIDRYDQSGVCEVFAILLHFFFLT
NYTWLMNEAFNLYIIITYSAHSQTDLNDSGSMLRYYIIGWVIPGVLVGAFVGTNTDTYYA
VDMCWISWDHFWLFIGPAVGIIAISILVMIFTAKEHNENSYTKTEKTNKIIMINMKGLWT
QLILVTVCWAFAFISIKMVDQILKYIYALFNCLQGAFFMVFYMLLHEEVRGVFKSQKKKQ
TMLQGYDFPDEHSLDSSISSSLLEKDKDSRKRRHPLKTLRKSTNNEDDKGSDCEMITSV
Download sequence
Identical sequences V3ZRD7
jgi|Lotgi1|169300|fgenesh2_pg.C_sca_84000029 XP_009065866.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]