SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|169787|fgenesh2_pg.C_sca_89000034 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Lotgi1|169787|fgenesh2_pg.C_sca_89000034
Domain Number - Region: 1-61
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0251
Family Growth factor receptor domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|169787|fgenesh2_pg.C_sca_89000034
Sequence length 175
Sequence
CTGNTWGKNCINRCSPSCSAGCLSDTGDCQCQAWTCLNGGSCGSDGRCQCQDGWTDMYCT
TALGQNLVSHPGKFNFSLTGGEIAGIAIGIVAMILLVAVITGVVLKRRFMARAGEGTQIK
YDRSQTVEIDSGLPNAMARDGGTGFVNPLAADPTIAATYTEMKSRESADADNTDA
Download sequence
Identical sequences V3ZQ14
XP_009066329.1.39240 jgi|Lotgi1|169787|fgenesh2_pg.C_sca_89000034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]