SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|170155|fgenesh2_pg.C_sca_94000020 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|170155|fgenesh2_pg.C_sca_94000020
Domain Number 1 Region: 24-66
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000792
Family Complement control module/SCR domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|170155|fgenesh2_pg.C_sca_94000020
Sequence length 282
Sequence
MLTSTNVAPRLVSGDAVKELRLSTYNRTPGTVVNLGCYNNYTLVGTDQITCSQAGEWSYY
TKPYCSSPQGNQLSELHKLLLGVGVGAAVLFVFVLIGIIGALIYRSKQRRKRARRFRHPS
TVTLAYSDFDGYRPFGIISPFSYDDREFFPDGSVKPVEKVKPSQLVPRSALTSSRTSQNT
SRPTSPKVTINGPLPEFRSRSRSVDGVVMAVPVQPDPRELERLYSTTLPNKLKRPSYSGE
WKDRQEYKRMDYFNRHALAEGHDPFLWRPGSTRWIFERKERV
Download sequence
Identical sequences V3ZDW4
XP_009067043.1.39240 jgi|Lotgi1|170155|fgenesh2_pg.C_sca_94000020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]