SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|170220|fgenesh2_pg.C_sca_95000016 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|170220|fgenesh2_pg.C_sca_95000016
Domain Number 1 Region: 216-446
Classification Level Classification E-value
Superfamily YWTD domain 4.58e-30
Family YWTD domain 0.0000627
Further Details:      
 
Domain Number 2 Region: 535-635
Classification Level Classification E-value
Superfamily YWTD domain 0.00000000157
Family YWTD domain 0.0013
Further Details:      
 
Domain Number 3 Region: 24-60
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000196
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 4 Region: 64-99
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000746
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 5 Region: 136-175
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000364
Family EGF-type module 0.013
Further Details:      
 
Domain Number 6 Region: 457-503
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000251
Family EGF-type module 0.014
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|170220|fgenesh2_pg.C_sca_95000016
Domain Number - Region: 106-143
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00344
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|170220|fgenesh2_pg.C_sca_95000016
Sequence length 636
Sequence
MAIGCSGFESSSRLYLILYFVDCIPCTEDLFQCDNCRCISKSWLCDHNNDCGDNSDEAHN
CSRYNCRPGEWACPHNGKCISIYNVCDNKRDCDKDEDEVMSCSWINCGVLSCDNKCRSTP
SGGVCHCNVGYHITPDNNRTCVDFNECGQWGYCDQGCQNKVGSFECQCTDGYTLVGIRTC
RAQNSDDMRLYIIDEGNLLSMDKSGDITQKLSLSDTQDIELDLRNNQMFWVNKSKIYRAS
IDNWTEKQLLPIKGLINPTQILYDWVGYNLYYLDEEAIRIDMYSLSSKLQRNIISDNIRT
PKSFTIDPIHGYMFFVDVGRKSKRNSAKIERAFMDGSHRLDLKLNKLLLPVSITVDIINE
RIFWVDSHLDHIETVNYHGLDRRTILSGGIQVPSALSLAVFEDYVYWTDATKKGVLKVNM
YGGDPEQIYETRGNIVGSIKVSHINKQPEPEKYPCKDNICQQICIISHTTDNSGLGYRCL
CGAGYQLADDSINCTKIDKFILFASMHAVRGIPVEESDTYSVDAIQPIIGPSRGRNGRNY
VAVDYIAENETVFFSDVRNLVIYQGKLGDSDPVPLVVNSIRTVEGLSVDWMSKNLYFTDY
AQRTVSVVRIEQPGDRRDIIKDLGNPRSIVVNPLKG
Download sequence
Identical sequences V3YVZ9
jgi|Lotgi1|170220|fgenesh2_pg.C_sca_95000016 XP_009067101.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]