SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|170221|fgenesh2_pg.C_sca_95000017 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|170221|fgenesh2_pg.C_sca_95000017
Domain Number 1 Region: 5-122
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-20
Family YWTD domain 0.0006
Further Details:      
 
Domain Number 2 Region: 180-218
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000367
Family LDL receptor-like module 0.00089
Further Details:      
 
Domain Number 3 Region: 125-174
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000431
Family EGF-type module 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|170221|fgenesh2_pg.C_sca_95000017
Sequence length 220
Sequence
MQTAYIARAYGDGSNVTKIRQHQLGWPNGLCVDFEADRLYWVDAYFDRIQSSDFNGNDLT
TLEGHSITHPFGISVYKDSIYFTDWRMEAILKIDKNGGKERRIRSGIGKMMGIKIFDKDL
QPISSQNPCTRRNGDCSHFCFPVPVSPSLIIIGRHCACPYGFKLKEDQRSCEPNPNEPNP
ASCPSGLYECRNRRCIPQSYKCDRDNDCLDNSDEDDCPTG
Download sequence
Identical sequences V4B1Q9
XP_009067102.1.39240 jgi|Lotgi1|170221|fgenesh2_pg.C_sca_95000017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]