SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|170222|fgenesh2_pg.C_sca_95000018 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|170222|fgenesh2_pg.C_sca_95000018
Domain Number 1 Region: 2026-2281
Classification Level Classification E-value
Superfamily YWTD domain 3.92e-53
Family YWTD domain 0.0000016
Further Details:      
 
Domain Number 2 Region: 373-633
Classification Level Classification E-value
Superfamily YWTD domain 8.63e-49
Family YWTD domain 0.00000305
Further Details:      
 
Domain Number 3 Region: 1017-1255
Classification Level Classification E-value
Superfamily YWTD domain 3.27e-36
Family YWTD domain 0.0000245
Further Details:      
 
Domain Number 4 Region: 3063-3316
Classification Level Classification E-value
Superfamily YWTD domain 3.79e-34
Family YWTD domain 0.0000176
Further Details:      
 
Domain Number 5 Region: 2290-2462
Classification Level Classification E-value
Superfamily YWTD domain 3.01e-33
Family YWTD domain 0.0000121
Further Details:      
 
Domain Number 6 Region: 684-932
Classification Level Classification E-value
Superfamily YWTD domain 4.45e-31
Family YWTD domain 0.00012
Further Details:      
 
Domain Number 7 Region: 1303-1514
Classification Level Classification E-value
Superfamily YWTD domain 1.12e-21
Family YWTD domain 0.00046
Further Details:      
 
Domain Number 8 Region: 274-363,634-677
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000408
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 9 Region: 1977-2024
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000179
Family EGF-type module 0.0056
Further Details:      
 
Domain Number 10 Region: 1601-1642
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000668
Family LDL receptor-like module 0.00091
Further Details:      
 
Domain Number 11 Region: 198-237
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000668
Family LDL receptor-like module 0.00079
Further Details:      
 
Domain Number 12 Region: 1767-1806
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000111
Family LDL receptor-like module 0.00095
Further Details:      
 
Domain Number 13 Region: 1852-1893
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000236
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 14 Region: 2-37
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000249
Family LDL receptor-like module 0.00059
Further Details:      
 
Domain Number 15 Region: 2628-2666
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000262
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 16 Region: 76-117
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000432
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 17 Region: 2800-2838
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000524
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 18 Region: 2587-2627
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000681
Family LDL receptor-like module 0.00074
Further Details:      
 
Domain Number 19 Region: 936-978,1260-1299,1508-1567
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000126
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 20 Region: 2548-2588
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 21 Region: 2758-2797
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000034
Family LDL receptor-like module 0.00078
Further Details:      
 
Domain Number 22 Region: 1947-1985
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000059
Family EGF-type module 0.024
Further Details:      
 
Domain Number 23 Region: 36-74
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000106
Family LDL receptor-like module 0.00096
Further Details:      
 
Domain Number 24 Region: 2844-2881
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000131
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 25 Region: 1564-1602
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000223
Family LDL receptor-like module 0.00072
Further Details:      
 
Domain Number 26 Region: 2976-3035
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000321
Family EGF-type module 0.011
Further Details:      
 
Domain Number 27 Region: 163-197
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000406
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 28 Region: 1895-1937
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000406
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 29 Region: 1678-1723
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000055
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 30 Region: 2931-2967
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000733
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 31 Region: 2510-2546
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000262
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 32 Region: 2714-2753
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000275
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 33 Region: 1722-1764
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000288
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 34 Region: 2887-2921
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000406
Family LDL receptor-like module 0.0026
Further Details:      
 
Domain Number 35 Region: 2669-2711
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000654
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 36 Region: 246-282
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000851
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 37 Region: 1641-1683
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000013
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 38 Region: 120-156
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000183
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 39 Region: 3375-3408
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000307
Family EGF-type module 0.011
Further Details:      
 
Domain Number 40 Region: 1809-1853
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000038
Family LDL receptor-like module 0.0021
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|170222|fgenesh2_pg.C_sca_95000018
Domain Number - Region: 2470-2509
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000637
Family EGF-type module 0.03
Further Details:      
 
Domain Number - Region: 3324-3360
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0297
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|170222|fgenesh2_pg.C_sca_95000018
Sequence length 3765
Sequence
VTCASNKYQCNNGRCISEVWLCDGDNDCGDMSDEKNCPEKTCRPDEFRCNNSLCISQALV
CDTDNDCGDSSDEGEFCTNHKCQPGFFQCDNKRCIPDHLVCNGGLDCFDESDEYDCPALN
CTGRRWTCKTVRQCISRKYQCDGVDDCTDASDEEDCATRAPDECHDNEFKCTVGGCIPET
WKCDGQEDCEDGSDEPSTCATPTCYSGRFRCNNGRCIFHGWVCDGDDDCGDNSDEAQSLT
CAPPPFSCPSGEWECPGTRVCINITSVCDGSIDCPQGHDESPVCNSESCRLENGGCSHRC
IQTPRGAECFCPEGQELNDTKICQDKNECDPPGICSQTCINTKGSYKCQCDEGYSLLPDK
KTCQASRNTSEVFLLVATRKTIIRSSLDAWMYKSLPLVNQRSLSAIDIDVATGHIYYSDT
GLKKIFRATYNGTDITEIISTGVDVIEDIAVDWIARNIYWTDYRMETVEVADIDGNERVV
LISTNITNPRGIEVDPRDGLRYLFWSDWGQNPKIERVGLDGSSRVAIVTDKIYWPNALTL
DYPNKRLYFADARLDFIDYCNYDGSGRHRMFSNDHFLRHPHALTIFEDRIYWTDRAANRI
SRCNKFNCTERTVMASNIARPLGIVAYHSVRQPIGSNSCEKKPCSHLCLLSPTSELGYKC
LCPVGFKMDATSHVCKQASEVVLLYMQPRMISGIKPDSKGKPSMIPVTSLVDGLDFDYDS
REGFIYYIEKENGSLRRIQINGQNASEFVPTAVIGQPNALAIDWLSNNLYWANEDMSTIE
VMKMTGEKHYRKILISNNGKETDVAAPLSICLDPVQGKLYWSDKGGNGVPAKIGVMNMDG
TKSKVLVSTDIRVPQYLTIDINNQALYWSDSFHQDTDSEPKSPGGLTVYKNRLYYTDSDY
EAIYEANFSNLTHPTQVKNNLPKLQSLKIYYDRHDSGSNGCSDNYGGCSQLCLPIGVNKQ
KKCDCGIGFVLQSNGDCQESNSFLLISQYKKLRGFGLSEQNPQEAMVPVGGEGRAISKIE
VIMKFGYIYWTDLNPGDKINKAASTLNRIKADGSEFQVVIKSGVGTNGIQGIAIDWLAGN
LYFTNAFTIETFIEACRLDGSYRRVIIREPQGRPRSIAVDPIKRYIYWADYGQHPKIERA
NLDGSNRTTLVSNGISFPRDIAVDIITHDVYWVDSVVDALQSISYNGENRQYIKINLPNP
FGVAVYGDWIYWVDRNLKKIFKGRKTKRSNDSIIVVKSDLPELRDVKIFDDSIQPKGESP
CINNNGGCDQLCFALPNKDDPTCVCASGKLDTDGKSCTAPSDFLIYAAENEIRGISLDLK
NMAAPIPPITGLRGAVAVDFDAKTQYIYFSQVGGKKISQVKKGSVKVEDILDNDINSTLS
NHDITSVEGMAFDWVSKRLYWADLFKKRIYSMGIDKSNKIELAVVNSPRAVAVDPCSGDR
IERSNIHGMYREIIIQTTVHPFSLTIYKQYIFWTDWTLRGVFRAEKHTGSDMKMLIQGIS
ARPMGIVVFSPDRQKCDDNPCAKFNGGCSHGCHPSPKGEPECSCQEGSGLVLGKDGKMCI
PENHNCTSTQFVCENGRCLIQRWVCDMDDDCRDNSDENPNHCALHTCDPTHFRCNNGRCI
PLRYRCDFDDDCRDNSDEFDCPYPTCGPDQFSCLNFRCIDKGQVCDGVDNCRDGNKTDEM
NCPPRVCPSNQVKCPNTNICIVRRYMCDGDDDCGDNYDENPLFCNQVTCAAGDFYCTETH
KCIPGAWHCDGENDCGSNEDESEYCSFNNRTCFGNQFTCDSGKCISSRWVCDGTDDCGDN
SDEADTLNCAERTCQPDTFTCESNKQAGSYPCIDRRRVCDGVRNCIGGEDEMQSCPVRSC
QPNQFQCTNGICISLRFYCDLDNDCGDNSDEPDQCVTPEPTCAGNEFRCDSGDCVSYNVV
CNKNPDCSDESDEKHCHIDECEKTEINQCEHECVDTLTSFHCECHTGYRLMSDRKACQDI
NECTDVPGACSQICENTEGSYKCKCTEGYQRQADGISCKKIDNIKPWLVFANRYYVRELS
TDGQNYRRVAQGFDNVVALDFDVKEDRLYFTDVKAHKIYRIYLNGTGQEVIIQHNVPSAE
GLSVDWIGRKLYWVDGRKSSLNVAELNGTNRCTLLKSQMRRPRAIVVDPVHGYIYWTDWG
VKSSIGRVGMDGSNATVDFVTNKMGWPNALTIDYDTGRLWWADAHLDIIEYINIDGSGRH
TVLQGVPHPFAITVFEDWMYWTDWNHLSIEKANKYTGANHTILRNITHRPMDIHVYHPLR
QKVEYFLYFRKLYWVDGRKSSLNVAELNGTNRCTLLKSQMRRPRAIVVDPVHGYIYWTDW
GVKSSIGRVGMDGSNATVDFVTNKMGWPNALTIDYDTGRLWWADAHLDIIEYINIDGSGR
HTVLQGVPHPFAITVFEDWMYWTDWNHLSIEKANKYTGANHTILRNITHRPMDIHVYHPL
RQKVGSRGSPCGKNNGGCSHVCLIGAGGDNYACKCPDFFVMTPDNKTCIANCSSSQFRCG
PTDDRCVPLLWKCDGDKDCKDGMDEPEDCPVKVCAPGQFQCKNNNCTFVFRVCDLHDDCG
DGSDEENCNTRQCESWQFKCNNYKCIPKKWQCDGEDDCGDGSDELSHSCGNSTCSVGQFM
CDNKRCIPATWKCDFDDDCGDGSDEKTSFNCESRSCLTGWWKCKTNYRCVPNWSRCDGED
DCRDNSDELEENCPVCHPTGDWKCANRKCIPKRWLCDFDDDCGDNSDEASDTCADKLRSC
SESEFRCDNKKCIQGKWRCDHDNDCGDGSDEDPQYCTKFKECDKDQFQCSSGHCISLNTI
CDGARDCFDASDEQNCTAPYPGNKFCPDSKFECANHICISTNWKCDGDNDCGDDSDETAE
VCKSVDCEDAGKFQCDNFKCIPKFKICDEINNCGDGSDENKPGLCKVQSNRICTEKEFKC
TNRNCIEGTRVCDNVDDCGDRSDEDGCNKDSDDSSCSKENGGCAQNCTSLKDGGYYCSCK
PGYQIGREDRKSCEDINECDRWGNNCPQKCQNIKGTYKCQCAEGFRDRQRKGTECKASDG
SLIIFFGIGGAIQQYRSSTKEYTNAILKSQRVQSIDVDVAWNLIFWTDKSEKKIKRATLP
PDATVSGVARTIVSFDVKQPEGIAVDWVGKNIYWADSLKKTISVAKNDGRYTRSLIATDL
DYPMGVAVIHDWDASENKPKIEYSWMNGDQRKVLVNSNLVYPTGITIDYFMNDRIYWCDY
KSNVIETMKYDGTDRHIVIKKGIYKPFNIDVFESMLYWSSRDEGRIIKMNKFGKGTNSTL
QTGLLLPTGVKVFHKKRSDLAVKNNCSDSSCSHLCLLTPVGFTCACPQGSSALPSNQNIC
DAPQEKPQSKPMTCDCRNGGTCVGTENIGFTCKCLEGYIGDFCEIAPVRVLESENLTSVI
IPVVVVIIIIILLVVVFVILRKKGILLSFKKFLPKGSNDMKKFRGIAQYNEAGDVNLKLP
YVTGGKPSTSNAPPDDILQDPTKPTNFCNPIILLSFKKFLPKGSNDMKKFRGIAQYNEAG
DVNLKLPYVTGGKPSTSNKNSRRSVDVKMQEDGSSSVGTYSTIRSIFTDNGASFYCPGSH
SVVTSGSFVSACESLQDRLHALDLSTDHNLRNSVIVKEFLFKGKSWDGRHSEDRPLGYGF
HSADRALRYGFHNERALGYGFHNERALGVGLHHSEFIALGYEFHSEGRALGVEYGEEILD
YSDILKKLLRKRPDSFCCEFLDDRDLGDVVKTEIENKIRFCLQRN
Download sequence
Identical sequences V3ZIN0
jgi|Lotgi1|170222|fgenesh2_pg.C_sca_95000018 XP_009067103.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]