SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|170497|fgenesh2_pg.C_sca_99000050 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|170497|fgenesh2_pg.C_sca_99000050
Domain Number 1 Region: 35-187
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000000000000712
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0072
Further Details:      
 
Domain Number 2 Region: 510-668
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000486
Family Trypanosoma sialidase, C-terminal domain 0.041
Further Details:      
 
Domain Number 3 Region: 724-888
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000993
Family Laminin G-like module 0.071
Further Details:      
 
Domain Number 4 Region: 191-227
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000175
Family EGF-type module 0.016
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|170497|fgenesh2_pg.C_sca_99000050
Domain Number - Region: 1652-1676
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000343
Family EGF-type module 0.081
Further Details:      
 
Domain Number - Region: 291-390
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000507
Family Glycosyl hydrolases family 16 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|170497|fgenesh2_pg.C_sca_99000050
Sequence length 1931
Sequence
MHGCVASRPEMIKLPQHLLCLVLLISTGTYSALVCNEELGLSNGALKNSAIKVSSFLANR
SKDKIRYDCCKGDIGAAWCPADGDEHPFVEIRLSKPQALTGIRFQHPVTDGHSYGHDFMK
KFTLKFVPALAIDGGFEEFNTDIPAIYNESMAYNVGLQPSVVTDRVRIEPTEVINKACFR
MELMGCEPSALCDDGFCNNGGECIGKKLCKCPAGFFGHQCQTEATQIKVQHFHYLSVTKT
TIVTSAYELHYQGQVSIKQQGSMSFLELAAGSTLQVPTKEKCFENLDDCADGFTYNVGVS
FNSIQMSTFDILKGGDWQKESGIELMYHAESKRLICTVGTSTLVWQLSVSIKLEIHHWYN
FQLSWSQSLGLKLLQNGKLVGSVLQASPRQVSQMAKRISFQIGYGIAVMYKLSEMRIVPL
IYSEAVRAGITEPIIPTTPLPTSSTQPPTTTITAIPTTESPCLKKVPENTDVISYDLTVR
DIIDGEIITPDLKIKYIGDVPPPSDHSIKVLDLNGTGQYIAVPTECLACLNSLVDCEHGF
TIQVSVAFHSEEHNVIFYSGVERFESGFKLTFSSGKFQAVLQAGFDKWLIDAPYQVQPGK
TYLIQLSWATKYGFQLFVDNYRVGEGEHLRLPTFFNNVTKPLYIGTEDRNTTSRFLLTNL
MVWSATRTVLVEKGILPAILTTPGPTTTLDPTAGFAWTFASINATKLVDHGLQINLKGVS
KSDKDGVYLQSSKQYLEISELSNTCTGNLEFCSNGISFEFEMKFFELKENTVIMSTGGEN
PNNPGVAVIYRFGQIQIVVNTKEKSWYSTIPRELITLSELHKFLISWSPKGSLEVYLNEK
YVTSTTHFVKRTTITAAYTGTLYIGHSFSTNTDLQSINCEVKSFHIWHITIEILIQIGIC
HCQRPTTTTNAPTTTTTPKPTTTTEKPTTAKEKPTTTTEKPTTTTEKPTTTTKEPTTSSC
PAGCISISDMTTRKPCPTRPPRTTTRTPTTTKKPTTTTKKPTTTTEKPTTTTKKPTTTTQ
APTTTLGIPIIGGSAILKPIVNSKGEAFLSCSIKTTIDTSNIQVKYSFTIFGKKNSEREL
KSNKFESLLSAKDLDENILGKKVVCTITARYLPNGRWSEIIRSNIFIAKVELITKGTVTL
IEGENEKKVDIKSNTPPQLLCPTGNKGRCEVQLVSTIIAAKKEYKCSKYVVIPQMVIGWT
PSGGLTKPFCGTSLSVSNWEKTIQIPVKATIDGLYDRDAYRQMKAEVVITGTVTQKTESY
SIGNELKVIAINRDFKAVCGSVNDPHMTTFDGLHYNNFASGEFVLYRHKTLPYEVRTLYK
PCSKWNPKGPSCNCGVAVRSGDDVITLSGCANGLYDKYSKHKHHHSHHANPISVQMYKNG
ELTPGTRVRRLGCGQKYEIILPTGSVVTVKSSYLSFINIWLKASAVDYGQSQGLCGIYNR
NKKDDLTDSSGKLITSGRYLKQFCESWRATKSMFTGVIASPLVKRPIYCSCISGYKSSCS
NTMDIFKCPSSTDKYDITDYLVKNAQLPHVDKPITGRKRRALPDPVTTVIPATFKNISME
EAEEYCMDYLDNSTAVKNCENITNNTNYTQNVENCAYDLHTTGDEGFATAHVDDIINLCI
TLATSQGTQYTDNDNQTSPTQAILATLCPLDCGDHGSCQSGVCVCEEGFTGAACDVGKTT
KPDIIPISPDSEPCDINRRDCSQVDILGFNFVDSADLSCHYQPIIVSDKIEIRGGSSTIK
ANYISMYQIGCPLPNPPHSAYISISNDGHTVSDARYLHLVHDSSCYDCTVDDDTNAHCSR
RVETCSIESQCYMAGKTNPEQSCQICDPQQSQLLWSVNTDPKCSAKKLTGSKDDDDEPLS
TKVIALAATSGVLGFITLISLAVICKQRSDAKLKRKESGFYNVGSPSTTTLAGSKPDLHS
YDNQTYDSGRL
Download sequence
Identical sequences V3ZMA4
XP_009067402.1.39240 jgi|Lotgi1|170497|fgenesh2_pg.C_sca_99000050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]