SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|170780|fgenesh2_pg.C_sca_104000004 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Lotgi1|170780|fgenesh2_pg.C_sca_104000004
Domain Number - Region: 151-262
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0324
Family Growth factor receptor domain 0.0068
Further Details:      
 
Domain Number - Region: 32-172
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0471
Family Growth factor receptor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|170780|fgenesh2_pg.C_sca_104000004
Sequence length 277
Sequence
MTTGSQECHHITEQCYNGCQPGYRGEDCTLNCQNGTYGDGCSKLCNKRHCKGSQHCYHIT
GQCTDGCQPGYRGYDCILKCQNGTYGDICSELCNKRHCRGSQDCHHISGQCYNGCTTGYT
GEDCRWHCLNGTYGDRCSKLCNKRHCTGSQECHHITGQCTDGCKPGYRGEDCTVECPDGF
YGAGCQKNCNNRKCLKNSTCDHVTGECIGGCSVGYSPTILDCTQGCSKKCSDRKCNDNLN
CNSKTGECIDGCQPGFQSIDCSYGNNIVLVLQPIKNI
Download sequence
Identical sequences V4CPQ7
jgi|Lotgi1|170780|fgenesh2_pg.C_sca_104000004 XP_009044876.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]