SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|171958|fgenesh2_pg.C_sca_123000026 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|171958|fgenesh2_pg.C_sca_123000026
Domain Number 1 Region: 336-586
Classification Level Classification E-value
Superfamily YWTD domain 1.57e-55
Family YWTD domain 0.0000016
Further Details:      
 
Domain Number 2 Region: 25-285
Classification Level Classification E-value
Superfamily YWTD domain 3.53e-51
Family YWTD domain 0.00000165
Further Details:      
 
Domain Number 3 Region: 640-899
Classification Level Classification E-value
Superfamily YWTD domain 8.11e-46
Family YWTD domain 0.00000654
Further Details:      
 
Domain Number 4 Region: 973-1194
Classification Level Classification E-value
Superfamily YWTD domain 6.67e-42
Family YWTD domain 0.0000373
Further Details:      
 
Domain Number 5 Region: 1259-1298
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000034
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 6 Region: 1300-1335
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000183
Family LDL receptor-like module 0.00088
Further Details:      
 
Domain Number 7 Region: 594-644
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000461
Family EGF-type module 0.0095
Further Details:      
 
Domain Number 8 Region: 288-333
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000238
Family EGF-type module 0.0038
Further Details:      
 
Domain Number 9 Region: 1218-1270
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000296
Family EGF-type module 0.012
Further Details:      
 
Domain Number 10 Region: 901-954
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000514
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|171958|fgenesh2_pg.C_sca_123000026
Domain Number - Region: 1335-1358
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0406
Family LDL receptor-like module 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|171958|fgenesh2_pg.C_sca_123000026
Sequence length 1601
Sequence
MDYSTRILVLFGILAVCNDIVSSTFLLFANRKDVRLINALDPKGNSTIVVTNQEDASAVD
FLYSANSIFWTDVSEEVIKRTYLNDTQNSIGVITTGLVSPDGLACDWLGLKLYWTDSETN
RIEVSNLDGSYRTVLFWQGLDQPRAIALDPINGYMYWSDWGETPKIERAGMDGNPLTRQV
IVDDNIYWPNGLTLDYTDSKIFWADGKLSYIHSCNFDGSDRRVVLDDSLPHPFALTLDGD
SLFWTDWKTHSIHVCDKRTGLQKSVVHDNIFSPMDIHVYSPQRQPRGKNPCGIRNGGCSH
LCLMAPIKPYYTCACPTGVLLQGDKRTCADGAENILFLARRTDLRRISLDTPDYTDVVLP
LTDIRHAIAIDYDPIEGYVYWTDDEVQAIRRSLLNGSNQEVIVSTEVYHPDGIAVDWIGR
NLYWTDTGTDRIEVARLNGTSRKVLISDNLDEPRALTLDPVSGYIYWTDWGKHAKIERAA
LDGSERKTIVDTNLGWPNGLTLDYEERKIYWGDAKTDTIESSDLDGNNRSTVVKENIPHI
FGFSLLGDFVYWTDWQRRSIERVNKHTGKDREVIIDQLPDLMGLKAVNVKKISGTNPCAI
KNGGCSHLCLHRPNLKTPTCACPMGLELISNGRTCIVPDAFLLFTIKDDIKRISLEVNHN
IQPIPIQGVRDAMSIDFDINDNRIYWTDVQLKSISRAYMNGSSVQHIIDFGVDFPEGMAV
DWVAHNIYWADMGTQRIEVARLDGSSRKVIVWKDLIDPRAIALDPPNGYMYWTVWGDEKR
PPHLERANLDGSLRKIIINDLGRVQDLCIDYIDKRMYWTNVDSKSIESSDMLGGDRKVIV
KRNVQEPMGLTQYEDIIYWTDTKSKSIECANKTTGKNHTVIHQDKVMVYDITVFHTSRQS
GWNSCGRLNGGCSHLCLYHNTNDFGNITYHCACPTHYTLHEENQTCEAPKNYLLLSQKTV
ISRFVMDPEDIDDADNPEVVLPIHNLKNVRALAYDPKDAFIYWIDNKNKVIKRGHNNGTN
VTVVVNEEGISPFDIAIDPFSRSIYWTCNKNNVINVSRLDSTPIGVVVPSGGMKPRSIAL
YPEKGLMYWTNMVSSPKIEKAAMDGTEKTTLFETNLEHPLALTIDKHSNKLCWADSALKH
IECSDLGGGNRVVVVDEGIHAPRGLAIYGNFLYWLDRDQQVIERIEKNTRKHRIHVRRYV
IGLSDLITVEHSLPATNHSCSINNHGCSHICLATSEGGARCSCPVNLELKQDEVTCAYPP
TCAPNEFTCLKGDVRCIPLVWRCDKLGECQDQSDEENCPNCSSSEFQCTDRKCIDSKFEC
DGKNDCADGSDESSCCKPNEYRCTNHQCITKDGKCDDKNLPFSERSNSTSTSNTTQYAIG
IVVGVVFLVLVIAVVFICRRRSHHSPVDDPDIMMVKKPLNPHSDSQTTPHTFSSRGNKSL
ILTTTVSIGSGSGSQLYDRNHVTGASSSSSTVTQYPKETLNPPPSPVTDRSMYTGDLYCS
INSLSTVRSSRPKKKKVRYNIPPPHTTPCSTDVCEDSEPYPGTIFHSVVELSYDSDPYPP
PPTPRSHYFSDEMSCPPSPSTEKSYFNPYPPPPSPVAHSDC
Download sequence
Identical sequences V4BA15
XP_009046773.1.39240 jgi|Lotgi1|171958|fgenesh2_pg.C_sca_123000026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]