SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|172822|fgenesh2_pg.C_sca_142000035 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|172822|fgenesh2_pg.C_sca_142000035
Domain Number 1 Region: 136-321
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.83e-28
Family Laminin G-like module 0.019
Further Details:      
 
Domain Number 2 Region: 376-437
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000167
Family VWC domain 0.003
Further Details:      
 
Domain Number 3 Region: 439-503
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000115
Family VWC domain 0.0097
Further Details:      
 
Domain Number 4 Region: 503-539
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000439
Family EGF-like domain of nidogen-1 0.082
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|172822|fgenesh2_pg.C_sca_142000035
Domain Number - Region: 32-137
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.0523
Family Pentapeptide repeats 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|172822|fgenesh2_pg.C_sca_142000035
Sequence length 543
Sequence
MVLDLMLLVVGFDVTRYNSIILVVKLRCWMLDLMLLGIMMLDLMFLGIMMLDLMLLGIMM
LDLMFLGIMMLDLMLLGIMMLDLMLLGIMVLDLMLLGIMVLDLMLLGIMVLDLMLLGIMV
LDLMLLGVGFDVTRYNGINLMDYINISENDAQAHPTSNNHNKTLALVMDETVRQIVLPDN
IAELALKLISNTSKISFLATVKQEIGNSGSIIALSAGMLRFLDIESRGGRDEIRFHYTHR
TQIQVETFPYRLGDNTWHKLAVILNDNQLSLYIDCNKIYERTIEPVDRTFKAGKLSLFIG
QRNRHHAFFRGYLKDIRIVGNDHGHLLQCKKENSGCPSIAQYEYLEDKLNSLYTEYNNMS
TKLTNAEKHIKDLQNCNCLNTCYVNGTLYKEGDIWKKEKCSICNCKNSSVMCNRVECPDI
KCLKPFSQKGQCCPSCLMSCFYSGQYYSHGENFQPRVCVKCICDNGETICLKQNPEEICP
KLNCTSNDTIHVEGECCPICKGTDFCGEGNDCHVNAVCVNLLTKYACQCNEGYQGDGRHC
GAC
Download sequence
Identical sequences V4B535
XP_009048246.1.39240 jgi|Lotgi1|172822|fgenesh2_pg.C_sca_142000035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]