SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|172907|fgenesh2_pg.C_sca_144000026 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|172907|fgenesh2_pg.C_sca_144000026
Domain Number 1 Region: 38-135
Classification Level Classification E-value
Superfamily EF-hand 0.000000000296
Family Polcalcin 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|172907|fgenesh2_pg.C_sca_144000026
Sequence length 139
Sequence
MNAFLLLTLVAGAFAASCRHDDHTTWTETQVIDLVTSHMNRDGDNVISELNIGIEFVLKY
DHNFRNGVELHEFTKQWVKTYHDEVALATHIFQHLDMDSSGSLDTDDIAPLIARVDTSGD
GLVQVNEFKAYLKAIYNAC
Download sequence
Identical sequences V4AAI4
XP_009048340.1.39240 jgi|Lotgi1|172907|fgenesh2_pg.C_sca_144000026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]