SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|173011|fgenesh2_pg.C_sca_146000054 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|173011|fgenesh2_pg.C_sca_146000054
Domain Number 1 Region: 347-620
Classification Level Classification E-value
Superfamily YWTD domain 8.76e-33
Family YWTD domain 0.0000641
Further Details:      
 
Domain Number 2 Region: 674-907
Classification Level Classification E-value
Superfamily YWTD domain 4.32e-26
Family YWTD domain 0.000082
Further Details:      
 
Domain Number 3 Region: 1179-1434
Classification Level Classification E-value
Superfamily YWTD domain 2.88e-25
Family YWTD domain 0.0005
Further Details:      
 
Domain Number 4 Region: 31-69
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000314
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 5 Region: 1018-1055
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000105
Family LDL receptor-like module 0.0009
Further Details:      
 
Domain Number 6 Region: 1097-1132
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000406
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 7 Region: 67-107
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000641
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 8 Region: 235-338,623-665
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000022
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 9 Region: 1053-1094
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000576
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 10 Region: 135-171
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000628
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 11 Region: 174-213
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000877
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 12 Region: 1136-1184
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000645
Family EGF-type module 0.023
Further Details:      
 
Domain Number 13 Region: 979-1015
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000236
Family LDL receptor-like module 0.003
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|173011|fgenesh2_pg.C_sca_146000054
Domain Number - Region: 934-982
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000184
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 1442-1474
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0402
Family EGF-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|173011|fgenesh2_pg.C_sca_146000054
Sequence length 1510
Sequence
MVKIFTLVLLASLFVSSHGILWDLFGSSKPVKNCTTSQFQCKNKHCIKKAWLCDGLEDCL
EGEDEANCTVEVCPISWFKCDNGRCIDPDFKCDGQDQCSDRSDEISCLNSDLKNCDYNSL
SMLTVLFPVNSDLKNCDYDSFRCKSGGECVPNDFVCDGSEDCNDGSDEHSCDQVNCATDQ
FLCPNTTLCINRYQMCDLIPDCVDGADEADNTCHTIERCERTPGSFMCTNLEKCLDVRKV
CNGRDDCLDGSDEPKNCSMECAKLGCSQACAPVKGSLTCLCVSGLELDKDEKTCVDTDEC
LSKKTWELRCSQICKNSVGSYECDCIHGYELEPDDHTCRVPGKEAILFYSTRTSITQLGL
NSGDTSYFRTDLTGISALAVDNSGKTIIFHHCTLQAVDSNGKTVYWASNTDKKVYKSRTD
EWILHRRRAIISVGLVSVESLVYDWVGANLYIVDSGRGEVVVCKPDGVSCSVILNELHSP
TSIAVDPHARNLYLSEAGNTRKISKSWMDGDNKQDFISDRLGQPTCLVIDYTIGRLYWAD
LTFGVIDSIKLDGTDRQVILAHEVHHPSLLVVFEDLMIWSDQVKHTLNSANKLKGRNRTH
LVSNVPRTTAAVVLHPSLQTPDVFGSPCQLEKCSHICLLSNNVAKYTCACPIDFQLGEDQ
HTCQRKGSSKMLLVAHDSDILQFSLNYIGGDPYTIYSSDDEEIQSLGYDPICQEIIHSFL
KYDHPVICKSSLDSNQEHKIIVKGDMKKIASLAVDWVARNVFWIDSGKKTLEVSHIDKEI
RSVLLTPADLDEPRALALNLQDGTMFICDWGMVEARIDVCDMDAAHCYHLVRHGLGKPNY
LTIDSITGRLFWTDAKLGEICSVTLNGENKMTHTVSTEEPLSLAVMNQMMYWTDWRTDTI
QSLNLTSKQYSILHSRMEGRTELTLIHQTIPVVNGCNQVDNGGCSHVCLAKHKNSKTCLC
PDNLILDDDLLTCVEDDYSCKPGQIKCRVNSTCMDPQQICDDNIDCPNKIDELNCPSKCK
TGHFRCSDGKCIPTRWMCDGTVDCINGTDEQTQNCIPQICTKRQFRCSEYLCEVKSVVCD
HFEDCPNGADERNCTDKCPPGHFQCDDGWCIAEDKNCDGIQDCADKSDEVECTGSECATM
NGNCSHQCESLGDQYNCSCFQDYELAEDGTTCLAKGVRPYLLVANYKGIHRISTNGQTGQ
TSIVDSNTPVLEVDIIMDTGTIVWSTYNETTNTATIHTVTGKQSHIVLEKTGHICSLAVD
WITRMVYYTSYTNTTGSIGCCQVDSALCTTLVSRPDWTPMSIAVHPLNGLLYWVDKEEDM
LLMSYLDGSFPQILVDSGVYSPVNLVIDYVKNILYWIDDFFGWMKSYDLNSDHLRIVRQT
LFKKPKSLDVFENVGYVSDLGGISRVGLYYGETNIMSRITNPTGLKIVHPLKQIKGLSLC
KTKSCQYLCVNIPNEARCLCPDVFTLNITDGNCYGKVFLIFSSNDSVRYCNVGIEQELDP
KLFPKGKRRM
Download sequence
Identical sequences V4AAC2
jgi|Lotgi1|173011|fgenesh2_pg.C_sca_146000054 XP_009048445.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]