SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|173242|fgenesh2_pg.C_sca_153000008 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|173242|fgenesh2_pg.C_sca_153000008
Domain Number 1 Region: 25-155
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000000000504
Family Rhodopsin-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|173242|fgenesh2_pg.C_sca_153000008
Sequence length 209
Sequence
MGEVVEEVQLESSSIRQKGELRRSAMGIIERARIRTLKMTLVIVGVFVLCWTPYFVFSAW
WWFDKRSPRLLHFHYGFGSPLAFPRESAAKTDPKLRRGLFLFAVSNSCMDPIVYEFQERR
VVIVTFKRGFKGSNLDGMFTINFKREFQRCCQCVNKDTELTDRIVNRGGSPAPISRPNSE
QSGSSYKNSERVYYRSSESHSSVPKRNMR
Download sequence
Identical sequences V4A8T0
jgi|Lotgi1|173242|fgenesh2_pg.C_sca_153000008 XP_009048956.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]