SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|173255|fgenesh2_pg.C_sca_153000021 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|173255|fgenesh2_pg.C_sca_153000021
Domain Number 1 Region: 60-122
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000025
Family Complement control module/SCR domain 0.0045
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|173255|fgenesh2_pg.C_sca_153000021
Domain Number - Region: 114-171
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000153
Family Complement control module/SCR domain 0.0054
Further Details:      
 
Domain Number - Region: 8-69
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00974
Family Complement control module/SCR domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|173255|fgenesh2_pg.C_sca_153000021
Sequence length 188
Sequence
MGFCSTVDCDRYILPINTIWLPRDRCEENKRFRCRKGYVSQVQTICKGGYWVLEPTCQAV
ECPQGVNITNSDDVTESGIFEEVFSFDCSVGFTQNGVTGILSCDENGTWTEQKACQAVEC
PQGENITLSDGVTESSIVGGLFNFSCSVGFIETGTLGCEENGTWTKQKACQVVLKAVGNK
GIPMIIYA
Download sequence
Identical sequences V4B259
jgi|Lotgi1|173255|fgenesh2_pg.C_sca_153000021 XP_009048969.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]