SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|173486|fgenesh2_pg.C_sca_161000008 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|173486|fgenesh2_pg.C_sca_161000008
Domain Number 1 Region: 395-440
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000474
Family EGF-type module 0.041
Further Details:      
 
Domain Number 2 Region: 198-244
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000131
Family EGF-type module 0.038
Further Details:      
 
Domain Number 3 Region: 319-366
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000161
Family EGF-type module 0.046
Further Details:      
 
Domain Number 4 Region: 689-730
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000194
Family EGF-type module 0.035
Further Details:      
 
Domain Number 5 Region: 48-89
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000241
Family EGF-type module 0.054
Further Details:      
 
Domain Number 6 Region: 123-169
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000282
Family EGF-type module 0.054
Further Details:      
 
Domain Number 7 Region: 475-513
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000369
Family EGF-type module 0.03
Further Details:      
 
Domain Number 8 Region: 617-659
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000469
Family EGF-type module 0.035
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|173486|fgenesh2_pg.C_sca_161000008
Domain Number - Region: 580-612
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000168
Family EGF-type module 0.03
Further Details:      
 
Domain Number - Region: 92-123
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0241
Family EGF-type module 0.032
Further Details:      
 
Domain Number - Region: 242-272
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0245
Family EGF-type module 0.031
Further Details:      
 
Domain Number - Region: 512-541
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0262
Family EGF-type module 0.029
Further Details:      
 
Domain Number - Region: 544-575
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0298
Family EGF-type module 0.031
Further Details:      
 
Domain Number - Region: 658-689
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0298
Family EGF-type module 0.031
Further Details:      
 
Domain Number - Region: 17-48
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0305
Family EGF-type module 0.032
Further Details:      
 
Domain Number - Region: 167-198
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0315
Family EGF-type module 0.031
Further Details:      
 
Domain Number - Region: 364-395
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0322
Family EGF-type module 0.031
Further Details:      
 
Domain Number - Region: 439-470
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0325
Family EGF-type module 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|173486|fgenesh2_pg.C_sca_161000008
Sequence length 854
Sequence
MTTVLSPFVSFLELIPDCQNGGQFVAEDGKLKCSCPSKTFGDDCSLGVCDVESENPCASG
STCIPGENIADVPNCVCTPGTTGKYCNELIPDCQNGGQFVAEDGKLKCSCPSKTFGDDCS
LGVCDVESENPCASGSTCIPGENIADVPNCVCTPGTTGKYCNDTIKDCKNGAEQKEVNGE
FICDCVAGTFGDDCSLGVCDVESENPCASGSTCIPGENIADDPNCVCFPGTTGKYCDDTI
KDCKNGAEQKEVNGEFICDCVAGTFGDDCMLYLKPSLIFTPQPSDYLYTYLMVSNNIAFD
DVKGILKKMLKWNHLQGLGVCDLESENPCASGSTCIPGENIADDPNCVCSPGTTGKYCDD
TIKDCKNGAEQKEVNGEFICDCVAGTFGDDCSLGVCDVESENPCANGSTCIPGENIADAP
RCVCSPGTTGKYCDDTIKDCKNGAEQKEVNGEFICDCVAGTFGDDCSLGVCDVENPCANG
STCIPGENITDVPNCVCLPGTTGKYCDDTIKDCKNGAEQKEVNGEFICDCVAGTFGDDCN
TIKDCKNGAEQKEVNGEFICDCVAGTFGDDCSLGVCDVENPCANGSTCIPGENITDVPNC
VCLPGTTGKYCDGLGVCDVENPCANGSTCIPGKNITDVPNCVCSPGTTGKYCDDTIKDCK
NGAEQKEVNGEFICDCVAGTFGDDCSLGVCDVESENPCANGSTCIPGENITDVPNCVCLP
GATGKYCDECGYNYSNETDLFPIPYMTETLCDKAKCDANCAIDTKCSCATVSGDGVCQLY
ETPVIFVSYDANEDACFERCNATSECKTIGLTKKEKIGYCFLFNVTLDQIPVGIKMSKTD
ESIAAEKRIRTHGT
Download sequence
Identical sequences V4A7C7
XP_009049477.1.39240 jgi|Lotgi1|173486|fgenesh2_pg.C_sca_161000008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]