SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|174065|fgenesh2_pg.C_sca_180000029 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|174065|fgenesh2_pg.C_sca_180000029
Domain Number 1 Region: 25-102
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000115
Family Growth factor receptor domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|174065|fgenesh2_pg.C_sca_180000029
Sequence length 107
Sequence
MSSKGLILVLVVTSISFLPVASLFCPRKCSIHDILACRPIPKHEECFPTQPFCSCCKTCS
GQMGSICNYKSPRCRPNMVCQHINGIQSKVIYRWVPWFTGRCQVMVD
Download sequence
Identical sequences V4AYG9
jgi|Lotgi1|174065|fgenesh2_pg.C_sca_180000029 XP_009050637.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]