SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|174094|fgenesh2_pg.C_sca_182000009 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|174094|fgenesh2_pg.C_sca_182000009
Domain Number 1 Region: 246-487
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 7.76e-26
Family beta 1,4 galactosyltransferase (b4GalT1) 0.012
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|174094|fgenesh2_pg.C_sca_182000009
Domain Number - Region: 22-93
Classification Level Classification E-value
Superfamily Prefoldin 0.0167
Family Prefoldin 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|174094|fgenesh2_pg.C_sca_182000009
Sequence length 517
Sequence
MKTMPRILLLLFSLSVMTMIFIARCGLYMDGYLSRTPNGLPTVSDKVDVKRQVRDVLQEK
ESQHSKVVQSLQKQIDNLENRLREAQVTEVEIQTYHIMPKNLSDFSQFFNEQLQAAEILQ
GMPLKTEYDVVSFNRFTLNRVYLVDPGLGKRVIEKPIGYKKKDLLEIITHAMNKLNENRT
GPYIKLYTMEDFLEGLYRIEPTTGTHYELYFQDIDSSVAYSYKKVILMRPFGPPMLVSKN
KVTTDQAWINLILPLSGRIETFRLFMERFVSVCIKQDKRVYLTVVYFGTDGLQEVKNIMS
AIAKHNKFKHMKLVTLNEKFARGRGLQIGALNWKSGDAMLFLCDVDIVFNGEFLERCRLN
TERGRRVYYPIVFSLYNPNVVYSLQDITIPNLKDQLVISKDTGFWRDFGYGMTCQYRSDF
LKIKGFDEHITGWGGEDVFLYQKYVRSDYLVVRATDPGIFHLWHEKYCDPNLTPEQYRSC
IRSKALNEASHAQLGLLAFKDEVDIHRSFVKKSHEKY
Download sequence
Identical sequences V4AYB7
jgi|Lotgi1|174094|fgenesh2_pg.C_sca_182000009 XP_009050679.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]