SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|174425|fgenesh2_pg.C_sca_195000014 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Lotgi1|174425|fgenesh2_pg.C_sca_195000014
Domain Number - Region: 82-112
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0408
Family Growth factor receptor domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|174425|fgenesh2_pg.C_sca_195000014
Sequence length 126
Sequence
MRLLVILTLSSLHLCQVYGESKICKTSDECDVGECCAIPPLFPIMSKRAELLPPKQKDGH
CKKFLVEGAYCNFFNKANAVDCGCADGLYCHFYPDPRIGKRKLAPGRRVCEKELILESTQ
PSKFFS
Download sequence
Identical sequences V4AWZ2
XP_009051261.1.39240 jgi|Lotgi1|174425|fgenesh2_pg.C_sca_195000014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]