SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|174475|fgenesh2_pg.C_sca_198000006 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|174475|fgenesh2_pg.C_sca_198000006
Domain Number 1 Region: 24-174
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.0000000000419
Family Pentapeptide repeats 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|174475|fgenesh2_pg.C_sca_198000006
Sequence length 182
Sequence
MSQGWPVGDLRFEAGTLMNYEHIVLTYMNYEHIVLTYMNCEHIVLTYMNCEHIVLTYMNC
EHRVLTSMNHEHIVLTYMNYEHIVLTYMNCEHRGLTSMNHEHIVLTYMNYEHIVLTYMNC
EHIVLTYMNCEHRVLTSINHEHIVLTYMNGEHIHVALTSTNHEHMVLTSMNLEHISKNHQ
HA
Download sequence
Identical sequences V4AT02
jgi|Lotgi1|174475|fgenesh2_pg.C_sca_198000006 XP_009051305.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]