SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|175429|fgenesh2_pg.C_sca_280000012 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Lotgi1|175429|fgenesh2_pg.C_sca_280000012
Domain Number - Region: 21-103
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000173
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number - Region: 1141-1225
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000876
Family Fibronectin type III 0.0071
Further Details:      
 
Domain Number - Region: 377-440
Classification Level Classification E-value
Superfamily Actin-crosslinking proteins 0.0706
Family Fascin 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|175429|fgenesh2_pg.C_sca_280000012
Sequence length 1457
Sequence
MSISLDRYHQGQHILFRPQVCSPINNCDQEYCTTKTNQRCRRCEGFVADKSWYRAYIISE
DKRTCNKACSWRPDSRCYPGSCRDELFSNCNCSDGFTGTHCNRITAIPDILYNQVRLTAH
NGETVDAPGDFGAGSPQPITWTNIMKPTNLYYSFQSNYYKQNSIRPPFVVDYKVGIIDGR
VLFTKYGLNGVQTQTNSCPTINKDNPKQGLLNCTKIIKPIFSVPFQHLERLSFKITTTIG
GFVKILDLERNVNNTYYYTPKSLSRDFEIKFDNVPPYHCIPVNNCKKTMLTDIDITKKVE
NTAYWDGWIDDDAGIAIYELEIFSMKSVGNELIIDKRIFDTETTLKSQQFNLTIPGVYSV
ILAAVDIAGNIRLARRCLIFDDNSQVSTVHDTNLKTTSASPSTNYLWQQNHGPVTIDWEN
RYINIKHHNGKYLAGIQDYHGLDSEYDDHYGTRTTKHIDNVQGIVRYETYYGIDDHGGST
IQPIDTDFTTTGTLKQSITISPTLQDGDTVKIFIRAYDIVDFYLEESTTVYFDMSPPVIK
DLWLTKGDDLNIAVHEFHDFDKLVIEWIAYDLHSGLETVEWKLHDNFTGDVILHGSQHIP
VQGEAQNLPECEKKYKTFSRGSDCYCTPAVGCYHQHFQVKPGVSLEDNNGLIDGKHQGVH
DYDYYIEVNVMNNAKLNTTLIYKITIDTSPPNVGVVHDGRYGEPEVDYQPERNLQAHWEG
FFDKESGLRYYHYGFSTRCLTAEEIFEIFEIQNTPGIFETVVTHATWFAPTDGQYFITVV
AYNTALQPSQPVCSDGVVIDSTRPIVSEIFIDQARIEAGLVSKDGKLYYINNRRLIHHMQ
NPDPACLQKGRPLEDISSFPIERYPNQTIQDRDLCQEETLPIQYLTQSYLVEHSHIYVNW
TGIDVESGIYDYQFGLSSERDSIPDLLPFHSTNHHAWYRGYHPQLTDGTEFFIHIKATNK
AGLETIQTLGPIIVHTSKPKFTGNIDVNLGPLIVHTSKPKFSGKIDVVLDNNLLVANWSN
AVVKDPGHSQLRYTTAIGTTEGGQEIIKFSDLNFNVPCLEALPPTCTVFDIMKLDWSLHH
GYKYYISIKIENTVGLHTVISSESLTYKSLLPSKGVVIDVGLKSEMDFFNILELEDSDYQ
LSTSMVSVRWYGFESQEEISTGINYKVGIRRENDSEFIQSVHVSQQTEYTFIDLQLQLHQ
KYIVSVTATVAGVGSVTSSSDGMTVVDRSEDLSDEVELKDGTACFQPTDLEANHYDNSTG
TFCGESTFQPSSSSYSMKWNISNKYYNIYPHINWSLQKQHQNTDIWLKEYEKELYTRDRM
LTLPYRLEVCESYRSHLQFCIDNVCSKPVYSEVMYQYEFRDCSDPILIRPAIVLDVFRQE
NRTGIELEPSARWNEPDVDYTPYNDLISAVWPTLRHRNYTWGLLEGPLQPTSTLYSNPDI
VIPDPCSHPSTIICGHS
Download sequence
Identical sequences V4BZ68
XP_009054892.1.39240 jgi|Lotgi1|175429|fgenesh2_pg.C_sca_280000012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]