SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|175477|fgenesh2_pg.C_sca_287000003 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Lotgi1|175477|fgenesh2_pg.C_sca_287000003
Domain Number - Region: 13-153
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0732
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number - Region: 129-154
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0825
Family EGF-type module 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|175477|fgenesh2_pg.C_sca_287000003
Sequence length 200
Sequence
MTITFISQIGLRKCNNNTYGAGCKKQCHDRNCEGSQYCNAKTGACKNGCKPGYTGQDCTT
VCPIGRYGIGCRRLCTDRNCKLSQKCHHVTGNCEEGCSPGFTGIDCVKECRPGFYGPDCT
SNCLNRHCTLQNDCNNRDGACICKDGYQGVDCTVKKSVNIDGSTKPAEINPTWIIVGTVL
GFVIGICIGVCGVMLVSRLR
Download sequence
Identical sequences V4BZ20
XP_009054945.1.39240 jgi|Lotgi1|175477|fgenesh2_pg.C_sca_287000003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]