SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|175491|fgenesh2_pg.C_sca_291000002 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Lotgi1|175491|fgenesh2_pg.C_sca_291000002
Domain Number - Region: 19-51
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00136
Family EGF-type module 0.035
Further Details:      
 
Domain Number - Region: 108-159
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0647
Family Hairpin loop containing domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|175491|fgenesh2_pg.C_sca_291000002
Sequence length 170
Sequence
MNNLLCSALLISVILILTDADCKNGGILVEENGTLKCNCPPNTFGDDCNCRYKFTNVTFL
EPDHYGESAGSDSAKCDENCAIDTRCSTSTMLPSGKTCYHYETPIILVTYDRDEDKCIGR
CNEMSECKTFGIDTGMNSACVLFNVTLDKIPDKMKRAYQTFFKAGEKICE
Download sequence
Identical sequences V4ABC5
jgi|Lotgi1|175491|fgenesh2_pg.C_sca_291000002 XP_009055199.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]