SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|175694|fgenesh2_pg.C_sca_347000001 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Lotgi1|175694|fgenesh2_pg.C_sca_347000001
Domain Number - Region: 13-61
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0399
Family Complement control module/SCR domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|175694|fgenesh2_pg.C_sca_347000001
Sequence length 481
Sequence
MATNIIKIKFTGCSTYPNITDANFDKDCNGNIVITCNEGFKMVQGLECVEEEWRYQNPIC
KRTGDEICCPIYPCKSLFKIKSSFSSHLTRKHHNWTKDSFNQQFVNDNITCDSAETEYSA
IDKEFTDQFDDTEHEGTGDNIDIETNETITDNNEDCSIDDYESNLMTSFALFYLKLQAKQ
LVPQSTIQFIVEEIGNLYSLGWENMKKMLKRKLVEQGLSNEVAEQLLVEIQNHNLFLHAT
DIDEGPFRSTYRRNIYYKSKFRHVPPVKCKIGQNIKGPVYSYYVHLEKLIASLFQDRSVL
DQYNNPIINFNRNELHDIRDGTHFKSNPFFQDNSRIQIMLYQDAFEIVNPIGAAKTKHKM
IGIHFTLGNFYPWNRSKIDTIQLVALCRDKDLSEFGAEVVFKNFITDCKRFENEGFFDVN
GITGPLFGTVISCLGDNLGSHYLGGFVENFSGEYWCRFCLHAKSDKDILPKEPRTKITRT
V
Download sequence
Identical sequences V4AGE1
jgi|Lotgi1|175694|fgenesh2_pg.C_sca_347000001 XP_009056835.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]