SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

  Home > Genomes > Lottia gigantea > jgi|Lotgi1|175727|fgenesh2_pg.C_sca_361000001

Domain assignment for jgi|Lotgi1|175727|fgenesh2_pg.C_sca_361000001 from Lottia gigantea

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:  jgi|Lotgi1|175727|fgenesh2_pg.C_sca_361000001
Domain Number 1 Region: 1-113
Classification Level Classification E-value
Superfamily YWTD domain 6.8e-19
Family YWTD domain 0.00032
Further Details:      
 
Domain Number 2 Region: 530-577
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000299
Family EGF-type module 0.0056
Further Details:      
 
Domain Number 3 Region: 641-678
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000903
Family LDL receptor-like module 0.00095
Further Details:      
 
Domain Number 4 Region: 199-240
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000969
Family LDL receptor-like module 0.00091
Further Details:      
 
Domain Number 5 Region: 403-448
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000183
Family LDL receptor-like module 0.00063
Further Details:      
 
Domain Number 6 Region: 367-404
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000367
Family LDL receptor-like module 0.00095
Further Details:      
 
Domain Number 7 Region: 677-720
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000772
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 8 Region: 719-759
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000117
Family LDL receptor-like module 0.00074
Further Details:      
 
Domain Number 9 Region: 760-799
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000157
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 10 Region: 500-538
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000262
Family EGF-type module 0.024
Further Details:      
 
Domain Number 11 Region: 579-654
Classification Level Classification E-value
Superfamily YWTD domain 0.00000000262
Family YWTD domain 0.0027
Further Details:      
 
Domain Number 12 Region: 162-200
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000367
Family LDL receptor-like module 0.00072
Further Details:      
 
Domain Number 13 Region: 276-321
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000929
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 14 Region: 449-490
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000942
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 15 Region: 320-362
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000445
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 16 Region: 241-281
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000288
Family LDL receptor-like module 0.0016
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|175727|fgenesh2_pg.C_sca_361000001
Domain Number - Region: 114-171
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000398
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|175727|fgenesh2_pg.C_sca_361000001
Sequence length 814
Sequence 
MAGNQRQAIVDSDLGWPNGLTIDYDEQMLYWADAMKDRIERSNIHGMYREIIIQTTVHPF
SLTIYKQYIFWTDWTLRGVFRAEKHTGSDMKMLIQGISARPMGIVVFSPDRQKCDDNPCA
KFNGGCSHGCHPSPKGEPECSCQEGSGLVLGKDGKMCIPENHNCTSTQFVCENGRCLIQR
WVCDMDDDCRDNSDENPNHCALHTCDPTHFRCNNGRCIPLRYRCDFDDDCRDNSDEFDCP
YPTCGPDQFSCLNFRCIDKGQVCDGVDNCRDGNKTDEMNCPPRVCPSNQVKCPNTNICIV
RRYMCDGDDDCGDNYDENPLFCNQVTCAAGDFYCTETHKCIPGAWHCDGENDCGSNEDES
EYCSFNNRTCFGNQFTCDSGKCISSRWVCDGTDDCGDNSDEADTLNCDYASCSSGQFSCD
NKRCVPQRWVCDGDDDCRDNSDEKENVCLTPEPTCAGNEFRCDSGDCVSYNVVCNKNPDC
SDESDEKHCHIDECEKTEINQCEHECVDTLTSFHCECHTGYRLMSDRKACQDINECTDVP
GACSQICENTEGSYKCKCTEGYQRQADGISCKKIDNIKPWLVFANRYYVRELSTDGQNYR
RVAQGFDNVVALDFDVKEDRLYFTDVKAHKIYRIYLNAFNNRTCFGNQFTCDSGKCISSR
WVCDGTDDCGDNSDEADTLNCAVKVCAPGQFQCKNNNCTFVFRVCDLHDDCGDGSDEENC
NTRQCESWQFKCNNYKCIPKKWQCDGEDDCGDGSDELSHSCGNSTCSVGQFMCDNKRCIP
ATWKCDFDDDCGDGSDEKTSFNCESRSCLTGWWT
Download sequence
Identical sequences V4AAK5
XP_009057196.1.39240 jgi|Lotgi1|175727|fgenesh2_pg.C_sca_361000001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]
Please cite: Gough, J., Karplus, K., Hughey, R. and Chothia, C. (2001). "Assignment of Homology to Genome Sequences using a Library of Hidden Markov Models that Represent all Proteins of Known Structure." J. Mol. Biol., 313(4), 903-919.

Please send feedback, comments or questions to superfamily@cs.bris.ac.uk or use the feedback form.

© Copyright 2013 The SUPERFAMILY authors and Julian Gough.