SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|175728|fgenesh2_pg.C_sca_361000002 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|175728|fgenesh2_pg.C_sca_361000002
Domain Number 1 Region: 943-1204
Classification Level Classification E-value
Superfamily YWTD domain 2.75e-36
Family YWTD domain 0.0000535
Further Details:      
 
Domain Number 2 Region: 316-564
Classification Level Classification E-value
Superfamily YWTD domain 1.7e-34
Family YWTD domain 0.000058
Further Details:      
 
Domain Number 3 Region: 663-699
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000537
Family LDL receptor-like module 0.00079
Further Details:      
 
Domain Number 4 Region: 20-98,199-277
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000157
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 5 Region: 751-826,885-934
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000251
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 6 Region: 623-661
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000236
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 7 Region: 708-744
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000209
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 8 Region: 567-614
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000293
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|175728|fgenesh2_pg.C_sca_361000002
Domain Number - Region: 128-188
Classification Level Classification E-value
Superfamily YWTD domain 0.0017
Family YWTD domain 0.0046
Further Details:      
 
Domain Number - Region: 838-896
Classification Level Classification E-value
Superfamily YWTD domain 0.00811
Family YWTD domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|175728|fgenesh2_pg.C_sca_361000002
Sequence length 1256
Sequence
MEKTKTKQMSKFGDKIIRLYLTLYFVDCIPCTEDLFQCDNCRCISKSWLCDHNNDCGDNS
DEAHNCSYPACSGSEYRCANERCISQQWLCDGNDECGDNSDELDCDTQSSSGQQVFEKFS
LYIYYFLRTILSGGIQVPSALSLAVFEDYVYWTDATKKGVLKVNMYGGDPEQIYETRGNI
VGSIKVSHINKQPQPARYNCRPGEWACPHNGKCISIYNVCDNKRDCDKDEDEVMSCSWIN
CGVLSCDNKCRSTPSGGVCHCNVGYHITPDNNRTCVEIDKFILFASMHAVRGIPVEESDT
YSVDAIQPIIGPSRGRNGRNYVAVDYIAENETVFFSDVRNLVIYQGKLGDSDPVPLVVNS
IRTVEDPVPLVVNSIRTVEGLSVDWMSKNLYFTDYAQRTVSVVRIEQPGDRRDVIKDLGN
PRSIVVNPLKGVIFFSDWLRNSMQTAYIARAYGDGSNVTKIRQHQLGWPNGLCVDFEADR
LYWVDAYFDRIQSSDFNGNDLTTLEGHSITHPFGISVYKDSIYFTDWRMEAILKIDKNGG
KERRIRSGIGKMMGIKIFDKDLQPISSQNPCTRRNGDCSHFCFPVPVSPSLIIIGRHCAC
PYGFKLKEDQRSCEPNPNEPNPASCPSGLYECRNRRCIPQSYKCDRDNDCLDNSDEDDCP
TATPTCYSGRFRCNNGRCIFHGWVCDGDDDCGDNSDEAQSLTCAPPPFSCPSGEWECPGT
RVCINITSVCDGSIDCPQGHDESPVCNSESCRLENGGCSHRCIQTPRGAECFCPEGQELN
DTKICQDKNECDPPGICSQTCINTKGSYKCQCDEGYSLLPDKKTCQASRNTSEVFLLVAT
RKTIIRSSLDAWMYKSLPLVNQRSLSAIDIDVATGHIYYSDTGLKKIFRATYNGSNSCEK
KPCSHLCLLSPTSELGYKCLCPVGFKMDATSHVCKQASEVVLLYMQPRMISGIKPDSKGK
PSMIPVTSLVDGLDFDYDSREGFIYYIEKENGSLRRIQINGQNASEFVPTAVIGQPNALA
IDWLSNNLYWANEDMSTIEVMKMMGEKHYRKILISNNGKETDVAAPLSICLDPVQGKLYW
SDKGGNGVPAKIGVMNMDGTKSKVLVSTDIRVPQYLTIDINNQALYWSDSFHQDISKYDI
NSGVKKRLIPNLSSPGGLTVYKNRLYYTDSDYEAIYEANFSNLTHPTQVKNNLPKLQSLK
IYYDRHDSGSNGCSDNYGGCSQLCLPVGVNKQKKCDCGIGFVLQSNGDCQGKHNYH
Download sequence
Identical sequences V4AFG5
jgi|Lotgi1|175728|fgenesh2_pg.C_sca_361000002 XP_009057197.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]