SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|175791|fgenesh2_pg.C_sca_403000009 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Lotgi1|175791|fgenesh2_pg.C_sca_403000009
Domain Number - Region: 158-191
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000251
Family EGF-type module 0.022
Further Details:      
 
Domain Number - Region: 403-435
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000404
Family EGF-type module 0.028
Further Details:      
 
Domain Number - Region: 343-375
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000779
Family EGF-type module 0.021
Further Details:      
 
Domain Number - Region: 283-315
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000838
Family EGF-type module 0.018
Further Details:      
 
Domain Number - Region: 313-342
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000838
Family EGF-type module 0.018
Further Details:      
 
Domain Number - Region: 127-157
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000868
Family EGF-type module 0.023
Further Details:      
 
Domain Number - Region: 253-285
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000928
Family EGF-type module 0.018
Further Details:      
 
Domain Number - Region: 373-406
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000958
Family EGF-type module 0.022
Further Details:      
 
Domain Number - Region: 221-250
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00174
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|175791|fgenesh2_pg.C_sca_403000009
Sequence length 456
Sequence
MMMESSINSATILPPYEEEFETVDNLHWSPETANNIYLFWIHQLQASTWGTSSNLPMNLR
KIEDVNIAKYTKDNWESLRPEWEPYAKRDTLCLGACLIKYNQAMKKTVFQNVSNNLTAPS
LSLKEKVNPCKNGGTEQPSGRCDCTDEYTGPTCEEKVNPCKNGGTEQPSGRCDCTDEYTG
PTCEDSLAIWHMSKVPLSTTSGSSFISSRIKTKISRVIQEKVNPCKNGGTESPSGRCDCT
DKYTGPTCEEKVNPCKNGGTESPSGRCDCTDKYTGPTCEEKVNPCKNGGTESPSGRCDCT
DKYTGPTCEEKVNPCKNGGTESPSGRCDCTDKYTGPTCEEKVNPCKNGGTEQPSGRCDCT
DKYTGPTCEEKVNPCKNGGTEQPSGRCDCTDEYTGPTCEEKANLCKNGGTEQPDGTCRCR
YKYTGPTCENKLPPMMKLTWVKDEKDGMYRVITTYE
Download sequence
Identical sequences V4ACB6
jgi|Lotgi1|175791|fgenesh2_pg.C_sca_403000009 XP_009058390.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]