SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|175836|fgenesh2_pg.C_sca_449000003 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Lotgi1|175836|fgenesh2_pg.C_sca_449000003
Domain Number - Region: 16-37
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0628
Family Antifungal peptide scarabaecin 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|175836|fgenesh2_pg.C_sca_449000003
Sequence length 138
Sequence
MELVFSFKRAYNLEVILVMVERKCPKGDSWNKARCKQIELHYTEVKCLWRGTEVRKASVF
KKDLSAVSGNSIAVLTIGFDIHHLQLDDQHSTVRKGKSSGNLPTRNSTATIGVFWGHGLY
DISDLLFTDEEAQMKWNR
Download sequence
Identical sequences V4BMN1
XP_009059099.1.39240 jgi|Lotgi1|175836|fgenesh2_pg.C_sca_449000003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]