SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|175846|fgenesh2_pg.C_sca_460000001 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Lotgi1|175846|fgenesh2_pg.C_sca_460000001
Domain Number - Region: 4-35
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00341
Family EGF-type module 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|175846|fgenesh2_pg.C_sca_460000001
Sequence length 227
Sequence
IIPDCKNGGTLVEENGKFKCNCPLNTFGDDCNCRFKFTNATSLFPDPYAERLVSDSAECD
ENCANDIRCSTSTMTYLKKCKLYETPVIFVSYDEDLCIEKCNEMSEYCRYKYSNVKSLTP
RAYAERTVSDSAKCDENCANDTKCSTSTTWLGTCLRYKTPIIFVSLDGKEDQCIEKCNEM
SECKTICTQNHTRNFSCYLFNVTLDKIPDNMKRPYKANYKVAEKICD
Download sequence
Identical sequences V4A993
XP_009059476.1.39240 jgi|Lotgi1|175846|fgenesh2_pg.C_sca_460000001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]