SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|175958|fgenesh2_pg.C_sca_591000001 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Lotgi1|175958|fgenesh2_pg.C_sca_591000001
Domain Number - Region: 47-163
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000408
Family Growth factor receptor domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|175958|fgenesh2_pg.C_sca_591000001
Sequence length 207
Sequence
MTVQWVSKPGYKEDDCTRVCATGTYGSECNNFCHCLNYDKCDVITGQCPNGCQTEWYGGN
CNTSCQSGKYGDRCSKLCNNRHCKRSQECHHITGQCTDGCKPGYKGYDCTLSCPNGAYGD
KCSKLCNNRHCKGSQECHHITGQCTDGCKPGYRRNDCIKKCQKRAYGDICSKGCDNRQCK
GSQHCPHITGKCYNGCTPGYREDDCTV
Download sequence
Identical sequences V3ZXP5
jgi|Lotgi1|175958|fgenesh2_pg.C_sca_591000001 XP_009061946.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]