SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|176281|fgenesh2_pg.C_sca_907000002 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|176281|fgenesh2_pg.C_sca_907000002
Domain Number 1 Region: 76-126
Classification Level Classification E-value
Superfamily Macro domain-like 0.0000000000353
Family Macro domain 0.0022
Further Details:      
 
Domain Number 2 Region: 240-365
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.0000634
Family Pentapeptide repeats 0.026
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|176281|fgenesh2_pg.C_sca_907000002
Domain Number - Region: 144-288
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.000569
Family Pentapeptide repeats 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|176281|fgenesh2_pg.C_sca_907000002
Sequence length 471
Sequence
MDDETVGIRVEGTEGRIQEILETLEKFSNGIDCQEIKIGNTIHKKVLESERGSEILKTIE
GQARCVIFKVSMNEEKALLGKFEINSATINVIQVDITTLSVDVIVNAANENLLLIGGVAG
AIRDKDCHRIDCHRIDSHIIYCQGIDCHRIDCHRVDCHRVDCHRIDSHRIDCHRIDCQGI
DCHRIVCHRIICHRIDCHRIDCHRIDCHRIDCHRIYCQGIDCHRIDCHRIDSHIIYCQGI
DCYRLDCHRVDCHRVDCHRVDCHRIDSHRIDCHRIYCQGIDCHRIYCQGIDCHRIDCHRI
YCQGIDCHRIYCQGIDCHRIVCHRIICHRIDCHGIDCHRINCHRIDCHRIYCQGIDCHRI
DCHRIDCHRIDSHIIYCQGIDCHRIDCHRIDCHRIDCHRIDCHRVDCHRVDCHRIDSHII
YCQGKDCQGIDCHRIDHHRIDCHRIDCHRIDCHRIDCHRIYCQGIDCYRML
Download sequence
Identical sequences V3ZEK4
jgi|Lotgi1|176281|fgenesh2_pg.C_sca_907000002 XP_009066800.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]