SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|176446|fgenesh2_pg.C_sca_1376000001 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|176446|fgenesh2_pg.C_sca_1376000001
Domain Number 1 Region: 99-148
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000473
Family Complement control module/SCR domain 0.0026
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|176446|fgenesh2_pg.C_sca_1376000001
Domain Number - Region: 41-82
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000353
Family Pan module (APPLE domain) 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|176446|fgenesh2_pg.C_sca_1376000001
Sequence length 154
Sequence
MTGFVLSFILCLRAVHVVSECTKTFLFDTAFVDTKLTNYFETTTQDSKLDCSRRCQDIEY
CTGFSYNPTSWRCELYDEVISTAKTELAAGTVTYKATEVCGPPPSIPNTNTQPADQYYLP
GYLMLYDCLRGSYQNSSIVCLKEGSWNTSAAEEY
Download sequence
Identical sequences V4B215
XP_009047762.1.39240 jgi|Lotgi1|176446|fgenesh2_pg.C_sca_1376000001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]