SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|176651|fgenesh2_pg.C_sca_2356000001 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|176651|fgenesh2_pg.C_sca_2356000001
Domain Number 1 Region: 230-281
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.6e-23
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 2 Region: 107-159
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.73e-21
Family Classic zinc finger, C2H2 0.0097
Further Details:      
 
Domain Number 3 Region: 285-336
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.78e-21
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 4 Region: 183-231
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.34e-19
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 5 Region: 149-181
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000276
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|176651|fgenesh2_pg.C_sca_2356000001
Domain Number - Region: 4-35
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00644
Family EGF-type module 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|176651|fgenesh2_pg.C_sca_2356000001
Sequence length 336
Sequence
IIPDCKNGGTLVEENGKFKCNCPLNTFGDDCNCRFKFTNATSLFPKPYAERLVSDSAECD
ENCANDTRCSTSTMTYLKKCKLYETPVIFVSYDEDLCIEKCNEMSECNLTIHLRTHTGEK
PYTCDVCNKSFSQKGNLTTLLRTHTGEKPYTCDVCNKSFSQKGNLTTHLRTHTGEKPYTC
DSKSNLTTHLRTHTGEKPYTCDVYNKSFSEKGNLTTHLRTHTGEKPYTCNLTTHLRTHTG
EKPYTCDVCNKSFSQKGNLTTHLRTHTGEKPYTCDVCNKSFSLKSKSNLTTHLRTHTGEK
PYTCDVCNESFSRKGNLTTHLRTHTREKPYTCDDCN
Download sequence
Identical sequences V4AQF9
jgi|Lotgi1|176651|fgenesh2_pg.C_sca_2356000001 XP_009053416.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]