SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|176746|fgenesh2_pg.C_sca_3136000001 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|176746|fgenesh2_pg.C_sca_3136000001
Domain Number 1 Region: 56-240
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.12e-23
Family Laminin G-like module 0.0036
Further Details:      
 
Domain Number 2 Region: 233-269
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000466
Family EGF-type module 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|176746|fgenesh2_pg.C_sca_3136000001
Sequence length 270
Sequence
MYDVTGLKKWDQDSGINKNKAQLPLTEVTVLQYPTGTGNLTIGHLKCWGSVQVPLDKSIT
FIKSSSYVMLHSWKSGDLRINIKTDQTNALILYQTPGKGMGNKFCIKIISANEVQFHFVI
NGKSILKTIYTPISFDTGEWHTIIVEHDKYNLRLSVDQSRSLYTLRSDIDDLIDFSDGIL
YIGGLPDGIAGELGETGPGLTGCVRGFVYNNKEKDLSRLIDGSMTGVTTDCMSSCWPNPC
LNGGVCEENWGSYNCICANKWIHYGNDCER
Download sequence
Identical sequences V4ADH9
jgi|Lotgi1|176746|fgenesh2_pg.C_sca_3136000001 XP_009056127.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]