SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|176773|fgenesh2_pg.C_sca_3728000001 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Lotgi1|176773|fgenesh2_pg.C_sca_3728000001
Domain Number - Region: 18-101
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000384
Family Growth factor receptor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|176773|fgenesh2_pg.C_sca_3728000001
Sequence length 107
Sequence
YILACPIGCADSNVLNILACPIGCADRQCFSTGCIKCQPGYCRAYHHHHHHHHNHHNHVE
TAIVVIMYYISACKDSNCKRCSSANNCQECKYRYELENGECRRKLFG
Download sequence
Identical sequences V4A5F9
jgi|Lotgi1|176773|fgenesh2_pg.C_sca_3728000001 XP_009057395.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]