SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|176918|fgenesh2_pg.C_sca_6697000001 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Lotgi1|176918|fgenesh2_pg.C_sca_6697000001
Domain Number - Region: 47-86
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000586
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|176918|fgenesh2_pg.C_sca_6697000001
Sequence length 108
Sequence
CSPINNCDQEYCTTKTNQRCRRCEGLVADKSWQRAYIISTDKRLCKKACSWRPDSRCYPG
TCRDELFSNCDCSDGFAGTHCNRITAIPDILYNQVTLTADNGETVDAP
Download sequence
Identical sequences V3Z5Q6
jgi|Lotgi1|176918|fgenesh2_pg.C_sca_6697000001 XP_009063204.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]