SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|181491|estExt_Genewise1.C_sca_20016 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|181491|estExt_Genewise1.C_sca_20016
Domain Number 1 Region: 262-373
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.88e-20
Family Spermadhesin, CUB domain 0.0024
Further Details:      
 
Domain Number 2 Region: 81-189
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000136
Family Growth factor receptor domain 0.015
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|181491|estExt_Genewise1.C_sca_20016
Domain Number - Region: 206-252
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00224
Family TNF receptor-like 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|181491|estExt_Genewise1.C_sca_20016
Sequence length 449
Sequence
MVRGTFKSLITAEFELQMDSRKHSRKCDFECMSRRTQRKLKKAIKILRRTIKKEKFTVRY
EGFNYEVIKKSFKADKHYDMTCKHGSILKNNICIACSIGTYMSKHEKKCLPCPSGTFQDE
EGRTECKKCPSKIPNSGVEGAANALQCLELCEPGHYSEEGLKPCKPCEIGKYQPQYGRTM
CMPCGPGLLTRKIAASHFRDCTTKEVCRKGYFYNLRRQRCEQCKHGTYQPSSGENFCIPC
PVGTTTDFRSSTDSSDCKNRRCGGYRGYYQGVIETPNYPGNYPINVGCTWKIKPEKHRRI
LIIIPQIELEANGKCGDRLVIRKSKSDESQNTFDTCRSQVRPVAFTTRSKKIWINFRSNN
NNTAKGFSIPFVTYHEQYQSLIEDIVQDKKLYNSKQHQQIFQDRKILKALLEVIAQPYNY
LKYANVSHTMFPRSFFRLLKPKVRKFFST
Download sequence
Identical sequences V4A104
jgi|Lotgi1|181491|estExt_Genewise1.C_sca_20016 XP_009051365.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]