SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|184955|estExt_Genewise1.C_sca_100441 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|184955|estExt_Genewise1.C_sca_100441
Domain Number 1 Region: 1560-1813
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.15e-55
Family Ankyrin repeat 0.0000000469
Further Details:      
 
Domain Number 2 Region: 113-247
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000157
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 3 Region: 381-512
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000073
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 4 Region: 572-704
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000863
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 5 Region: 863-906
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000474
Family EGF-type module 0.0053
Further Details:      
 
Domain Number 6 Region: 275-398
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000675
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 7 Region: 243-281
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000357
Family EGF-type module 0.0046
Further Details:      
 
Domain Number 8 Region: 888-1020
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000643
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 9 Region: 1004-1132
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000126
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 10 Region: 735-775
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000697
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 11 Region: 505-547
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000111
Family EGF-type module 0.019
Further Details:      
 
Domain Number 12 Region: 701-742
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000133
Family EGF-type module 0.005
Further Details:      
 
Domain Number 13 Region: 49-87
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000025
Family EGF-type module 0.011
Further Details:      
 
Domain Number 14 Region: 9-47
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000536
Family EGF-type module 0.015
Further Details:      
 
Domain Number 15 Region: 1205-1233
Classification Level Classification E-value
Superfamily Notch domain 0.0000000602
Family Notch domain 0.0044
Further Details:      
 
Domain Number 16 Region: 778-820
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000809
Family EGF-type module 0.021
Further Details:      
 
Domain Number 17 Region: 1240-1272
Classification Level Classification E-value
Superfamily Notch domain 0.000000719
Family Notch domain 0.0038
Further Details:      
 
Domain Number 18 Region: 831-868
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000643
Family EGF-type module 0.017
Further Details:      
 
Domain Number 19 Region: 89-124
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000162
Family EGF-type module 0.051
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|184955|estExt_Genewise1.C_sca_100441
Domain Number - Region: 1157-1189
Classification Level Classification E-value
Superfamily Notch domain 0.000128
Family Notch domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|184955|estExt_Genewise1.C_sca_100441
Sequence length 1818
Sequence
MTGDLCQIDVDECETTPFICQNGGTCMNHNDGFMCICVNGWTGSDCSENIDDCKNNPCFN
GGNCEDRVGYFYCKCPRGKTGMRCHLDDACESNPCNAGASCETSPIDGSPICTCKRGWTG
DTCSRDVDECTESADTPCEHGGTCINTPGSYKCDCAVGFTGPWCEVNINECSSNPCINDG
TCLDEKGAYRCLCMPGFTGRNCEVEYDECGSNPCINGGVCQDLVNKFKCTCPAGFEGPTC
AVNIDECETFPCLNGGTCNDQINTYTCTCKTGYSGVHCQENVDNCRKVDCGHGTCVDGLD
TYTCSCLPGYTGLLCQYDIDECSSNPCKFGGTCSNLDNSYECRCPYGTSGQNCEKNYNEC
VSNPCHNGATCIDGINRYNCKCKPGYEGTHCELDIDDCASQPCHNGGKCTDLINKFKCEC
PAGYYDAECRSNVNECGSNPCMNYGTCVDGVNKFECLCLDGYGGHRCQNDINDCVSNPCQ
HGGTCNDHLNSYSCDCKPGFEGKNCDKNINECASNPCVHGECVDLANEYHCNCNPPYSGK
NCEQELNPCHPSPCQNHAQCVPTNNYKDFECRCPTGFTGKLCNQDVDECASGSPCRNGAQ
CVNKNGSFKCICLRGYEGKRCEVNHDDCAPNPCINGGTCVDEIGGYSCRCVDGFGGQHCQ
NDIDECASNPCMHGSTCTDYVNSYTCTCRLGFSGVHCEVNDNDCTKSSCLNDGKCIDGVN
NFTCQCKGGFTGSICQTRINPCDTNPCMNAGTCFNHNGNYYCNCPYGFQGTHCERVQDWC
KNNPCQNSGTCEQFANNFRCTCTSDWTGEKCDIRRVPCNSAAALKGVDVSKLCRNGGICK
NLGGTTHECICQAGYEGSYCEREINECASAPCKNGATCKDLVNHYTCQCMTGFQGQNCEY
NIDDCANQPCANNGVCHDLVDDFKCSCPAGTLGLLCEINSNDCFDNACYHGGTCVDKIGH
YECKCPPGFAGPRCEGDVNECSSNPCSALGTQDCVQLDNDYRCQCKAGFSGRLCENRIQC
SEAPCKNGGTCTNTDSGPKCSCLKGYSGDYCEFQSADCDSSPCQNDGTCRPTQDGYFCLC
PAGASGINCEIDEMDECLSSPCKNDGTCHDKIGYYECYCPRYYTGIHCQNYDVNAVPGIG
RPVTMKPSLNLNPDKELCEQYGCEAKANNGKCDNECNMHACDYDNKECSYGMKPWKECSG
MRDGVFCWKVFKDGTCNPQCNNEECLYDGFDCQTKLKECNPIYDSYCKKYYGNGHCDQGC
DTEECEWDGLDCDKSPERLAEGTLVIIVLVEPEAFRNMSKEFLRKLGHLLRAVVRVLKDK
NGSPMIYPWQQKEGDDVSDVIRVKRWAETKVYLEIDNRGCYKYSTDECFDNTDNAAQFVA
AALQRNDADLGMPVGKIESLGKEPTVDSPAITFVYIVVACGAILLITLVVIIVISRKRER
AVTWFPEGFFNKRGSEKAGVRNRRGPDGEEMKDVQKGSHHSQLDKMDDRHGDWGEDEEEH
PKAKRQRIDEQGDSSDQSLVNFEIQDSRQWTQKHMEAANVTNPSILTLTPPQGDDPIDTK
DINARGPGGMTPLMLASLRGNTLDTSCDDESGSAEGNEEDNRAADVINNLLFQGASINLQ
TDRTGETSLHLAARYARADAAKVLLDAGADCNALDSTGRTPLHTAVAADAQGVFQILLRN
RSTNLNAKMYDGTTPLILAARLAIEDMVEDLINADADINAFDNNGKTALHWSAAVNNVEA
TESLLERNANRDAQDNKDETPLFLAAREGSFEAAKALLNHYANREITDHLECLPREVADE
RHHHDIVQLLDTYKVNSP
Download sequence
Identical sequences V4BGJ2
XP_009044486.1.39240 jgi|Lotgi1|184955|estExt_Genewise1.C_sca_100441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]