SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|187701|estExt_Genewise1.C_sca_200232 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|187701|estExt_Genewise1.C_sca_200232
Domain Number 1 Region: 4-180
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.6e-62
Family G proteins 0.00000211
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|187701|estExt_Genewise1.C_sca_200232
Sequence length 201
Sequence
MAREYDHLFKLLIIGDSGVGKSSLLLRFADNTFSGTYITTIGVDFKIRTVDVGGEKVKLQ
IWDTAGQERFRTITSTYYRGTHGVIVVYDVSSGESFANVKRWLHEIDQNCDVVNRILVGN
KDDDPDRKVVVSSDAQRFADQMSIQLFETSAKDNKNVEEMFLAITKLVLQSKKEQQKKIA
DQPQTIKLDGSRKNSSKKKCC
Download sequence
Identical sequences V4AUD5
XP_009051960.1.39240 jgi|Lotgi1|187701|estExt_Genewise1.C_sca_200232

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]