SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|188920|estExt_Genewise1.C_sca_260301 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Lotgi1|188920|estExt_Genewise1.C_sca_260301
Domain Number - Region: 349-373
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000534
Family Integrin beta EGF-like domains 0.027
Further Details:      
 
Domain Number - Region: 380-405
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00544
Family Integrin beta EGF-like domains 0.057
Further Details:      
 
Domain Number - Region: 419-448
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0109
Family Laminin-type module 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|188920|estExt_Genewise1.C_sca_260301
Sequence length 481
Sequence
MFLEVFNISATVLCILFLIGHRKCDTIQNSKHHAELMMDLLQPYKNYHGQRLKKSNRHIR
ECQEIKYGNVTHSKVKVKPDTNISYPLVEVKHLTKEIGSYYYKNPVTIRYQRVDFPLNTL
SVLEPGEPGTCREGHGTRSITSKTALSGNCIVGVNGGFFNTTTGACLGNIVSNGRLVQDS
QGLQNAHFGITEDGYIYVGYLSELDLITQQFKQLLGGVLWLIRDGEKYIDKSKQMECPDV
EETGTIETFIEVQSARSAVGHDKDGRVIMVQVDGKTNARGVNLHEFTDILLELGVVNAIN
LDGGGSTTTVINHTLVNYPSDKCADGTFSCEREISTILCVHEPECQPNDCNQHGHCVLGK
CVCDGYWVGSDCSSLSCPFSCSHHGTCTKDGCICDDGWYGINCSTPCKPGYYGSNCAHQC
YCLNHGTCNSQTGHCVCSPGFTGKYCESLCEFGYYGDKCNNLCTCDNGCFCHHVTGSCNL
S
Download sequence
Identical sequences V3ZUA8
jgi|Lotgi1|188920|estExt_Genewise1.C_sca_260301 XP_009054264.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]